(data stored in SCRATCH zone)

EMBL: CP000271.PE171

CP000271.PE171       Location/Qualifiers
FT   CDS_pept        complement(207195..207632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2856"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2856"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33139"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S00"
FT                   /protein_id="ABE33139.1"
FT                   /translation="MAHAARATQAEEPIRRPSSAPTLTEMSAAGLRAFFNIARDWNLSA
FT                   EEQIVLLGSPGRSTYFKWKAAPETARLGRDTLERLSLLLGIYKALQILLPQASTADTWI
FT                   KRPNSAPPFGGRRALDRMLAGNISDLVAVRQYLDAMRGGWA"
     atggctcacg ctgctcgtgc cacccaagcc gaagagccga ttcgtcggcc gtcttccgcg        60
     cccacgctga cggaaatgtc cgcggcgggt ctacgcgcgt tcttcaatat cgctcgcgac       120
     tggaacttga gcgcggaaga gcagatcgtg ctgctaggct cgccgggccg ctccacctac       180
     ttcaaatgga aagcggcgcc tgaaacggcc cgcctcgggc gcgacacgct ggaacgcctg       240
     tcgctgctgc tcggtatcta caaggcgctg caaatcctgc tgccgcaagc cagcaccgcc       300
     gacacctgga tcaaacgtcc caacagcgcg ccgccgttcg gcggccgccg cgcgctggac       360
     cgcatgctgg cgggcaatat cagcgacctc gtggccgtgc gccagtatct cgacgcaatg       420
     cgaggcggct gggcgtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page