(data stored in ACNUC7421 zone)

EMBL: CP000271.PE172

CP000271.PE172       Location/Qualifiers
FT   CDS_pept        207719..208393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ9"
FT                   /protein_id="ABE33140.1"
FT                   /translation="MTVEDQEKQEMRVRAVAAGAALAVWCMSGAAVAAGYAEVWNPPEE
FT                   TGHTTKQAGKKTGPATTGGTSAVGSKGASKAAPQHMAGAGHAASSVASAHGNKPSAHAS
FT                   VKKVAASGITKSKTQAAGANKTQRKAAVMTQSKKPNAQVVQAKPGQGKVAQANLVPRRT
FT                   AHPPAAKVAAKSDAAKPAASGVNVPALSANPAPSTKVDANPANASSNPATASSGSLPPI
FT                   IH"
     atgacagtcg aagatcagga gaagcaggag atgagggttc gagcggtagc agcaggggcg        60
     gcgcttgccg tgtggtgtat gtcgggtgcg gccgtggctg ccggttatgc cgaggtgtgg       120
     aatccgcccg aggagaccgg gcacaccacg aagcaggccg ggaaaaaaac cgggccggcc       180
     accaccggag gcacgtctgc tgtcggctcg aaaggcgctt caaaggccgc tccgcagcat       240
     atggcgggcg ctgggcatgc agcgtcgagc gttgcgtcgg cacatggcaa caagccctcg       300
     gcgcacgcaa gcgtcaaaaa ggtggcggcc agcggcatca cgaagagcaa gacccaggca       360
     gcaggcgcga acaagaccca aaggaaagcg gccgtcatga cgcagagtaa aaagccgaac       420
     gcacaggtcg ttcaggcaaa gcccgggcaa ggcaaagtcg cgcaggccaa tctggtcccg       480
     cgcaggacag ctcatccgcc agcggccaaa gtcgcggcga aatctgatgc cgcaaaaccg       540
     gccgcatctg gcgtgaacgt gccggctttg tcggcaaacc cggcgccgtc cacgaaagtt       600
     gatgccaatc cggcgaatgc atcgagcaat cccgctacag ccagcagcgg ctcgctgccg       660
     ccgatcatcc actga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page