(data stored in ACNUC7421 zone)

EMBL: CP000271.PE174

CP000271.PE174       Location/Qualifiers
FT   CDS_pept        209596..209979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2853"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33142"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ7"
FT                   /protein_id="ABE33142.1"
FT                   /translation="MPLTRIALRAGKPVEYRKALTESIQRSLVETFNVPKDDIFMLITE
FT                   HEAGNFVYDNQYLNVERSDDLVIIQITLNNTRTLEQKKTLYKRMADELAESPGLRREDV
FT                   FINLVEVLKENWSFGNGIAQYAL"
     atgccgctca cccgaattgc attgcgcgca ggcaagcccg tcgaataccg gaaggcgctg        60
     acggagagca tccagcgttc gctggtggag acattcaacg tgccgaaaga cgacatcttc       120
     atgctgatca ccgagcatga agccggcaat tttgtgtatg acaaccagta cttgaacgtc       180
     gagcgaagcg acgacctcgt gatcattcag atcaccctga acaacacgcg cacgctcgag       240
     cagaagaaga ccctttacaa gcgaatggcg gacgaactgg cggaatcgcc ggggctgcga       300
     cgagaggatg ttttcattaa tctcgtcgag gtattgaagg aaaactggtc gtttggcaac       360
     gggattgcgc agtacgcgct gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page