(data stored in ACNUC7421 zone)

EMBL: CP000271.PE177

CP000271.PE177       Location/Qualifiers
FT   CDS_pept        complement(212011..212712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2850"
FT                   /product="ABC molybdate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2850"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33145"
FT                   /db_xref="GOA:Q13RZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ4"
FT                   /protein_id="ABE33145.1"
FT                   /translation="MLLAVDIRKTFQSAERRFTLDVAFQATSQRVVLFGPSGAGKSLTL
FT                   QAIAGLLRPDEGTITLHGNALFDSARGIDLKPQARRVAYLFQDFALFPHLNVRQNIGFG
FT                   LQHGWLNPRARISHPQIDYWLDALELKSVAGNHPAQLSGGQKQRVALARALVAQPRLLL
FT                   LDEPFSALDSALRERMRRELSELQTRLDIPMVLITHDPDDVAAFGDQVVQVSNGQVREN
FT                   QPFAGYARSEP"
     atgctgctcg ccgtcgacat ccgcaagacc ttccagagcg ccgagcgccg cttcacgctc        60
     gacgtcgcgt tccaggccac ctcgcagcgc gtcgtgctgt tcggaccatc gggcgcgggc       120
     aagagtctga cgttgcaggc tatcgcgggc ctgctgcgcc ccgacgaagg cacgatcacg       180
     ctgcacggca acgcgctgtt cgacagcgcg cgcggcatcg atctgaagcc gcaagcgcgc       240
     agggtcgcct atctgtttca ggacttcgcg ctatttccgc atctgaacgt gcggcagaac       300
     atcggcttcg gcttgcagca cggttggctc aacccgcgtg cgcggatctc gcatccgcag       360
     atcgattact ggctggatgc gctggaattg aagagcgtgg ccggcaatca tccggcgcag       420
     ctttccggtg ggcaaaagca gcgcgtggca ctggcgcgag cgctcgtcgc gcaacctcgg       480
     ttgctgttac tggacgagcc gttttcggcg ctcgacagcg ccttgcgtga gcgcatgcgc       540
     cgcgaactgt ccgagctgca aacgcggctc gatattccaa tggtcctgat cacgcacgat       600
     cccgacgatg tcgccgcctt cggcgatcag gtcgtgcagg tcagtaatgg ccaggtgcgc       660
     gagaatcagc cgttcgccgg ctacgcgcgc agcgagccct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page