(data stored in ACNUC7421 zone)

EMBL: CP000271.PE178

CP000271.PE178       Location/Qualifiers
FT   CDS_pept        complement(212714..213388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2849"
FT                   /product="ABC molybdate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2849"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33146"
FT                   /db_xref="GOA:Q13RZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ3"
FT                   /protein_id="ABE33146.1"
FT                   /translation="MQQAWIPLLLSLKVAGWATALNLVFGVAAGLGLSRWRSGARDVVD
FT                   SLLMLPLVMPPTVLGYYLLVLLGRRGLIGSWLDRFDIQLVFTWQGAVIASTVVAFPLVL
FT                   KSARAAFEAVDPQLEQAARTLGVSETAVFFRVTLPLAARGILAGGLLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAVYSAVQAGDDSTANFLVLVTSVTCVVILLLAGRLVPQHTLLK
FT                   SG"
     atgcaacagg cctggatccc gctcctgctg tcgctgaaag tggcgggctg ggcgaccgcg        60
     ctcaatctgg tgttcggcgt cgcggcgggc ctgggcctgt cgcgctggcg ctccggcgcg       120
     cgcgacgtgg tcgattcgct cctgatgctc ccgctcgtca tgccgcccac cgtgctcggc       180
     tattacctgc tcgttctgct cggacggcgc ggcttgatcg gcagctggct cgaccgcttc       240
     gacattcagt tggtgttcac ctggcagggc gcggtgatcg cgtcaacggt ggtggccttc       300
     ccgctcgtgc tgaagtccgc gcgcgccgct ttcgaagccg tcgatccgca actcgaacag       360
     gccgcgcgca cgctcggcgt cagcgaaacg gccgtgttct ttcgcgtcac gctgccgctc       420
     gccgcgcgcg gcattctcgc cggcggcctg ctggcgttcg cccgggcgct cggcgaattc       480
     ggcgcgacgc tgatgatcgc gggcaatctg ccgggacgca cgcaaacgct ttccgtggcg       540
     gtctattcgg ccgtgcaggc gggcgacgac agcaccgcga atttcctcgt gctcgtgact       600
     tcggtgacgt gcgtcgtgat cctgttgctc gcgggacgtc tcgtgccgca gcacacactc       660
     ctgaagtccg gttga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page