(data stored in SCRATCH zone)

EMBL: CP000271.PE179

CP000271.PE179       Location/Qualifiers
FT   CDS_pept        complement(213411..214184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2848"
FT                   /product="ABC molybdate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33147"
FT                   /db_xref="GOA:Q13RZ2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ2"
FT                   /protein_id="ABE33147.1"
FT                   /translation="MTLARRLLKQALFVASAVSVAISANARADELVVSAAASLTNAFKA
FT                   VSEVFEQQHPGTKVLLNFGASDVLMQQIVKGAPADVFASADQKAMDKAVAEKVIVPASR
FT                   KDFAANSLVLIVPTDSHFTPTSLNDLASASVKRVAYGDPASVPIGRYAQGALQAAGVWD
FT                   AVSAKAVLASNVRQSLDYVSRGEVDAGFAFSTDAAIMPDKVKVAMNVPTQTPVTYPIAQ
FT                   VEGSRHAADAQAFINFVLSPAGQSVLARYGFKPAH"
     atgacactcg cccgccgcct tttgaagcaa gcgctgttcg tcgccagcgc cgtctccgtt        60
     gccatcagcg ccaatgcgcg cgccgacgaa ctggtggtct ccgccgccgc cagcctgacc       120
     aacgcgttca aggcggtcag cgaagtattc gagcagcagc atccgggcac caaggtgctg       180
     ctgaacttcg gcgcctccga cgtgctgatg cagcagatcg tcaagggcgc gcccgccgac       240
     gtgttcgcat ccgcggacca gaaggcaatg gacaaggccg tcgccgaaaa agtgatcgta       300
     ccggcctcac gcaaggactt cgccgccaat tcgctggtac tgatcgtgcc gacggacagc       360
     catttcacgc cgacaagcct gaacgatctg gcatcggcga gcgttaagcg cgtcgcgtac       420
     ggtgatccgg cttccgtgcc gatcggccgt tacgcgcagg gcgcgctgca ggccgctggc       480
     gtatgggacg ccgtgagcgc gaaggccgtg ctggcgtcga acgtacgtca aagcctcgac       540
     tatgtatcgc gtggcgaagt cgacgccggc ttcgcgttca gcaccgacgc cgccatcatg       600
     ccggacaagg tcaaggtcgc gatgaacgtg ccgacgcaaa cgccggtcac ctatccgatc       660
     gcgcaagtgg aaggcagccg ccacgccgcg gacgcccagg ccttcatcaa cttcgtgctg       720
     tcgccggccg gccagtccgt gctcgccaga tacggcttca agcccgcgca ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page