(data stored in SCRATCH zone)

EMBL: CP000271.PE180

CP000271.PE180       Location/Qualifiers
FT   CDS_pept        complement(214319..215020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2847"
FT                   /product="Putative phosphoesterase, PA-phosphatase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2847"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33148"
FT                   /db_xref="GOA:Q13RZ1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RZ1"
FT                   /protein_id="ABE33148.1"
FT                   /translation="MPDLPAHLWYSITNLGGAGLTLPLAFAIALWLAVGYTWRMAAGWL
FT                   ALLGAAIGIVTVTKLAFLGWGVGVRELDFTGVSGHAMLSTAVYPVVLFLMLLPARPAIR
FT                   LIGVLLGLAAGIAVGLSRVVLSAHSPSEAITGCLTGALAALVFVRLAWHAEPGRLSALP
FT                   VAASMMVLALVMHGVHVPTQRWVTHIALKVSGHDRPFIRAKWKAVRDVRPATAPLSQTL
FT                   NTLAPPHSSRA"
     atgcccgatt tacctgccca cctctggtac tcgatcacca acctcggcgg cgccggcctc        60
     acgctgccgc tcgcgttcgc catcgcgctg tggctggcgg tcggctatac ctggcgcatg       120
     gccgcgggct ggctggcgct gctcggcgcg gccattggca ttgtgaccgt aacgaagctg       180
     gcgtttctcg gctggggtgt cggcgtgcgc gaactggact ttaccggcgt aagcggtcac       240
     gccatgctgt ccaccgctgt ctatccggtc gtgctgttcc tcatgctgtt gccggcgcgc       300
     ccggccattc gcctgatcgg cgtcctgctc ggccttgccg cgggaatcgc ggtggggttg       360
     tcgcgggtcg tgctgagcgc gcattcgccg tcggaagcca ttaccggctg tctgaccggc       420
     gcgctggcgg cactggtgtt cgtccgtctc gcgtggcacg ccgagccggg ccggctgtcg       480
     gcgctgccgg tggccgccag catgatggtg ctcgcgctag tcatgcacgg cgtgcacgtg       540
     ccgacccagc gctgggtcac gcatatcgcc ctgaaagtat ccggtcacga ccggccgttc       600
     attcgcgcga agtggaaagc cgtgcgcgac gtccgtccgg ccaccgcgcc gctgtcgcaa       660
     acactgaata cgctggcgcc gccgcattcg tcccgcgcct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page