(data stored in SCRATCH zone)

EMBL: CP000271.PE182

CP000271.PE182       Location/Qualifiers
FT   CDS_pept        216697..216876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2845"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2845"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33150"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY9"
FT                   /protein_id="ABE33150.1"
FT                   /translation="MYLLSRLFLFLTKSPDQLAKERADAFLAEATDLYDLEFRMRKLDR
FT                   EANVRQPSWMSQQH"
     atgtatctgc ttagccgcct gtttctgttt ctgaccaagt cgcccgatca actcgcgaaa        60
     gaacgcgccg acgcattcct cgcagaagca accgatctgt acgatctgga attccgcatg       120
     cgcaagctgg accgcgaggc aaatgttcgc caaccgtcgt ggatgagcca gcagcactaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page