(data stored in SCRATCH zone)

EMBL: CP000271.PE184

CP000271.PE184       Location/Qualifiers
FT   CDS_pept        complement(218830..219249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2843"
FT                   /product="Organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2843"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33152"
FT                   /db_xref="GOA:Q13RY7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY7"
FT                   /protein_id="ABE33152.1"
FT                   /translation="MNILYKASATSTGGRDGRAVSSDNALDVKLAAPRELGGTGAAGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQHKQTLPADTQVTAEVGIGPNDKGGFALDIDLRVSLP
FT                   GLDANAARELVDAAHQVCPYSNATRNNVAVRLQIA"
     atgaacatcc tctacaaagc aagcgcaacg agcaccggtg gccgcgacgg ccgggcggtg        60
     tcgtcggata atgcattgga cgtcaagctg gcggcaccgc gtgaactggg cggcaccggc       120
     gcggcgggca cgaacccgga acaactgttc gcagcgggct actcggcgtg tttcctgagc       180
     gcaatgaagt ttgtcgccgg gcagcacaag cagaccttgc cggcagacac gcaggtcact       240
     gccgaagtcg gcattggtcc gaacgacaag ggcggcttcg cgctcgatat cgatctgcgc       300
     gtctcgctgc cgggtctcga cgcaaacgcg gcaagggaac tggtcgacgc agcgcatcag       360
     gtttgcccgt actcgaacgc cacgcgcaat aacgtcgcgg tccgtttgca aatcgcctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page