(data stored in ACNUC7421 zone)

EMBL: CP000271.PE186

CP000271.PE186       Location/Qualifiers
FT   CDS_pept        complement(220049..220855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2841"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2841"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33154"
FT                   /db_xref="GOA:Q13RY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY5"
FT                   /protein_id="ABE33154.1"
FT                   /translation="MQLIEVPAKAGYVWFRQGIWLFRKNPLAFLTLFFTYLLVMTLVSQ
FT                   IPVIGGVLPLAFIPGVAVGFMAACRNTIAGKPVFPTILVDGFHSYGPVVAKRLLVLGVL
FT                   YVVAMALVLAGSALADGGMLLKVMLGGATMDQDAIANSNIPLAVLTALALYIPVAMIFW
FT                   FSPILTAWHDVPPVKAMFFSIVSCWRNRGAFVVFGALWFAVAITVSLGLSALMQALGAG
FT                   DFAFAVLMPATMIVTTMLYCSFYATYRGCFGVQTPETPDLPTTPAA"
     atgcaactga tcgaagtccc cgcgaaagcc ggctatgtgt ggttccggca gggtatctgg        60
     ctgttccgta agaacccgct cgcgttcctg acgctgttct tcacctatct gctggtgatg       120
     acgctcgtct cgcaaattcc ggtgatcggc ggcgtgctgc cgctggcgtt cattccaggc       180
     gttgcagtcg gtttcatggc cgcgtgccgc aacacgatcg ccggcaagcc ggtttttccg       240
     accattctgg tggacggctt tcactcgtac gggccggtgg tcgcgaagcg gctgctggtg       300
     ctcggtgtgc tctatgtcgt cgcgatggcg ctggtgctgg ccggttcggc gctcgccgac       360
     ggcggcatgc tgctgaaggt gatgctcggt ggcgccacga tggaccagga cgcgatcgcc       420
     aacagcaata ttccgctggc ggtgctcacg gctttggcgc tctacattcc ggtcgcgatg       480
     attttctggt tctcgccgat tctcaccgca tggcacgacg tgccgcccgt caaggcaatg       540
     ttcttcagca tcgtcagttg ctggcgcaac cgcggcgcgt tcgtcgtgtt cggcgcgcta       600
     tggttcgcgg tggcgataac ggtgtcgctc ggcctgtccg cgttgatgca ggcgctgggt       660
     gccggcgact tcgcgttcgc ggtcctgatg cccgccacga tgatcgtcac gaccatgctg       720
     tactgctcgt tctacgcgac ctatcgcggc tgcttcggcg tgcagacacc cgaaaccccg       780
     gacctgccga ccacaccggc ggcctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page