(data stored in ACNUC7421 zone)

EMBL: CP000271.PE187

CP000271.PE187       Location/Qualifiers
FT   CDS_pept        complement(220846..221841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2840"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2840"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33155"
FT                   /db_xref="GOA:Q13RY4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RY4"
FT                   /protein_id="ABE33155.1"
FT                   /translation="MAVFTAVTEPQLAEWMRHYDLGDVVEFRGISSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAEQLPFYLDLMRHLAAHRVPVPDPMPREDGALFGLLQGKPAAIVTRL
FT                   EGAPELAPGVEHCIEVGQMLARMHLAGRDYPAYQPNLRSLPWWKETVPTILPFLEGGQR
FT                   ELLSSELAYQEAFFASADYAALPEGPCHADLFRDNAMFAHAEPGTGHEVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGKLDAARTEAMLRAYQTVRPFTAEENRHWGDMLRAG
FT                   AYRFWVSRLYDFHLPRAAELLKPHDPGHFERILRERLSGVALPGIHTSCN"
     atggctgtct tcaccgctgt cactgaaccc caacttgcag aatggatgcg tcattacgat        60
     ctcggcgacg tcgtcgaatt tcgtggcatc tcctccggta tcgaaaacag caacttcttt       120
     ctgacgacaa cgcgcggcga atacgtcctc acgatcttcg aaaagctgac ggccgaacaa       180
     ctgccgttct atctcgacct catgcggcat ctggccgcgc accgcgtgcc ggtgccggac       240
     cccatgccac gcgaagacgg cgccctgttc ggcctgttgc aaggcaagcc cgccgccatc       300
     gtgaccaggc tcgagggcgc gccggagctg gcgccgggcg tcgagcactg tatcgaggtc       360
     gggcagatgc tcgcgcgcat gcatctggca ggacgcgact acccggccta tcagccgaat       420
     ctgcgcagcc tgccgtggtg gaaggaaacc gtgccgacca tcctgccgtt tctggaaggc       480
     gggcaacgcg agctgctgtc gtccgaactg gcgtatcagg aagctttttt cgcctcggcc       540
     gattacgccg cgctgcctga aggcccgtgc cacgccgacc tgttccgcga caatgccatg       600
     ttcgcccacg ccgagcccgg cacgggccac gaggtgcgcc tgggcggttt cttcgacttc       660
     tatttcgccg gctgcgacaa gtggctgttc gacgtggcgg taacggtcaa cgactggtgc       720
     gtcgacctcg ccaccggcaa actcgacgcg gcgcgcaccg aagcaatgct gcgcgcttac       780
     cagaccgtgc gcccgttcac agcggaagaa aaccgccatt ggggcgacat gctgcgcgcg       840
     ggcgcgtacc gtttttgggt ctcacgcctg tatgatttcc atttgccgcg cgcggccgag       900
     ttgctcaaac cgcacgatcc cggccatttc gagcgcatcc tgcgcgaacg cctgtccggc       960
     gttgcacttc caggcattca tacctcatgc aactga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page