(data stored in ACNUC7421 zone)

EMBL: CP000271.PE188

CP000271.PE188       Location/Qualifiers
FT   CDS_pept        complement(222067..222462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2839"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33156"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RY3"
FT                   /protein_id="ABE33156.1"
FT                   /translation="MKPLLPVAVALALAFGNAAMAAQPVDDTPPPGAPQSANERAGLPD
FT                   LEKINRPAAEVSSKVEINVPRTPSFYERSPNGTEITEYRDKGKPVEINVHSNLGTRYQM
FT                   SAPLDTSPTVRDNGRASTRLPSVHLTY"
     atgaagccgc tccttcccgt cgccgttgca ctggccctcg cctttggcaa cgccgcgatg        60
     gctgcccagc ctgtcgatga cactccgccc cccggcgcgc cccagtccgc caatgaacgg       120
     gccggcctgc ccgacctgga gaagatcaat cgtccggccg cggaggtcag ctcgaaggtc       180
     gaaatcaacg ttccgcgcac gccaagcttt tacgaacgca gtcccaacgg caccgaaatc       240
     accgaatacc gcgacaaagg caagcccgtc gaaatcaacg tgcattcgaa cctaggcacg       300
     cgctaccaga tgagcgcgcc gctcgacacg tcgcccaccg tgcgcgacaa cggccgcgcg       360
     agcacgcgtt tgccgtcggt gcacctgacc tattga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page