(data stored in ACNUC7421 zone)

EMBL: CP000271.PE192

CP000271.PE192       Location/Qualifiers
FT   CDS_pept        complement(225695..226438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2835"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33160"
FT                   /db_xref="GOA:Q13RX9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX9"
FT                   /protein_id="ABE33160.1"
FT                   /translation="MTKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPNSPYYKLATQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQSGNQWQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELAEVL
FT                   TLIQTKKSRHVPIILVGAEFWEGLLAWFRNSLTPMGLINPADMDLMQVIDDPDQVLEAV
FT                   LKFYEDREEAEPQPTKSDEDRMFYL"
     atgactaaga gaaaagtgat tccgagtctg cgatcactcg cagatcaaga gcgcgcaacg        60
     gccaaaaagg cacgcgcatc gtggcagatg ttcacgatta tggcagagtt tatcgaggcg       120
     accgagtacc tctcggagat tcgcccggct gtcagcatat atggttcggc gcgcctgaaa       180
     ccgaactcgc cctactacaa actcgccacg caaatcgcgc gcaagttgtc ggacgcgggc       240
     tttgcggtga tctcgggcgg cggcccgggc atcatggagg cggccaacaa gggtgcccat       300
     gcaggcaagg cgccttcggt tggtctgaac atcgaattac cgcacgagca atcgggcaat       360
     cagtggcaag acatctcgtt gcgcttccgc catttcttca cgcgcaaggt cacgttcgtg       420
     aagaattccg acgcggtgat cgtgatgccc ggcggcttcg gcacgctgga cgaactcgcc       480
     gaagtgctca cgctgatcca gaccaagaag tcgcgtcatg tgccgatcat tctggtgggc       540
     gccgaattct gggaaggtct gcttgcgtgg ttcaggaact cgctcacgcc aatgggcctg       600
     atcaatccgg ccgacatgga cctcatgcag gtcatcgacg atcccgatca ggtgctcgaa       660
     gcggtactga agttctatga agaccgagaa gaagccgagc cgcaaccaac caagtcggac       720
     gaagaccgga tgttttatct gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page