(data stored in SCRATCH zone)

EMBL: CP000271.PE197

CP000271.PE197       Location/Qualifiers
FT   CDS_pept        complement(233024..234130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2830"
FT                   /product="Putative osmotic adaptation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2830"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33165"
FT                   /db_xref="GOA:Q13RX4"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX4"
FT                   /protein_id="ABE33165.1"
FT                   /translation="MSNLSNALQLRSVHSQLPVTAYFDEALLTREIDTLFKKGPRYIGH
FT                   DLMVPEAGNYFALPSESEGRVLVRNQQSQVELLSNVCRHRQAIMLNGRGQTENIVCPLH
FT                   RWTYDLNGQLLGAPHFADNPCLNLGATPLQNWQGLLFEAQGRNVARDLARLGTKEHFDF
FT                   SGFMFDHVEVHECNYNWKTFIEVYLEDYHVAPFHPGLGSFVNCDDLTWEFGDWYSVQTV
FT                   GVHKDLEQPGSPTYRKWHDEVLRFRGGNPPDFGAIWMVYYPGIMIEWYPHVLVVSWLIP
FT                   RGPQKTTNVVEFYYPEEIALFEREFVEAERAAYMETAREDDEIAERMDAGRRALMNRGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRELGTI"
     atgtccaatc tgagcaatgc attgcagttg cggtctgtcc acagccagct gccagtcacg        60
     gcttactttg acgaagcgct tctaacgcgc gaaatcgaca cccttttcaa gaaaggtcct       120
     cgctacatcg gccacgatct catggtgccc gaggcgggga attattttgc tttgccgagc       180
     gagagcgaag ggcgtgtgct cgtccgtaac cagcaatcgc aagtcgaact gctgtcgaac       240
     gtgtgccgcc accggcaagc catcatgctc aacggccgcg gccagacgga gaatatcgtc       300
     tgccccttgc atcgctggac gtacgacctg aacggccagc tcctcggtgc gcctcatttt       360
     gcggataacc cctgcctgaa tctcggcgcc acgccgctgc agaactggca aggcctgctg       420
     ttcgaagcgc aggggcgcaa cgtcgcgcgc gatctggcgc gcctcggcac caaggaacat       480
     ttcgattttt cgggcttcat gttcgatcac gtcgaagtcc acgagtgcaa ctacaactgg       540
     aagaccttta tcgaggtcta tctggaggac tatcacgtcg cgccgttcca tccggggctg       600
     ggcagtttcg tcaattgcga cgacctgacg tgggagttcg gcgactggta tagcgtccag       660
     acggttggcg tgcacaagga tctggagcag ccgggcagcc ccacctaccg caagtggcac       720
     gacgaagtgc tgcgttttcg cggcggcaat ccgcctgact tcggcgcgat ctggatggtg       780
     tactacccgg gcattatgat cgagtggtat ccgcacgtgc tggtagtgtc gtggctgatt       840
     ccgcgcggtc cgcagaaaac caccaacgtg gtggagttct attaccctga ggaaatcgcg       900
     ctgttcgagc gggagttcgt cgaagccgag cgcgccgcct acatggaaac cgcccgtgaa       960
     gacgacgaga tcgccgaacg catggacgcc ggccgccgcg cgctgatgaa tcgcggtgaa      1020
     tcgcaggtcg gcccttatca gagcccgatg gaagacggca tgcagcactt ccacgagttc      1080
     ctgcggcgtg agctcggcac gatctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page