(data stored in SCRATCH zone)

EMBL: CP000271.PE198

CP000271.PE198       Location/Qualifiers
FT   CDS_pept        234415..234723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2829"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2829"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33166"
FT                   /db_xref="GOA:Q13RX3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RX3"
FT                   /protein_id="ABE33166.1"
FT                   /translation="MAKTASKDTAATPAEGVDTTPLPENYEAAQAELEGLVARMESGNL
FT                   SLEESLTAYRRGAALVAFCQQQLEKVEQQVRVLDGETLKPLPMNTAGTAATESGDDL"
     atggcgaaga ccgcgtcgaa agatactgca gccacgccag ccgaaggcgt cgacaccaca        60
     ccgctgcccg agaattacga ggccgctcag gcggagctgg aagggctggt tgcccgcatg       120
     gaaagcggca acctcagcct cgaggagtcg cttaccgcct accggcgtgg cgccgccctc       180
     gtggcgtttt gccagcagca gctcgagaag gtcgagcagc aggtgcgcgt gctcgacggc       240
     gagacgctca agccgctgcc catgaatacc gcaggcacag ccgctactga aagcggggac       300
     gacctatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page