(data stored in SCRATCH zone)

EMBL: CP000271.PE2

CP000271.PE2         Location/Qualifiers
FT   CDS_pept        1134..2192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3027"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32970"
FT                   /db_xref="GOA:Q13SG9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG9"
FT                   /protein_id="ABE32970.1"
FT                   /translation="MKPSQFAKGFQARPDSTSSEKRTALDRLNAIDGIVKNDARHSEAA
FT                   GRVIAPGTPSQSLTEVDAVDAANESAAYRTWRLEHGYRPGQVIELALKTIKPSPFNPRH
FT                   FYLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKAIV
FT                   VDLPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDRHFQSQKELAEHLGLDESTVA
FT                   VALSISKLPEVVMHEMVARPDRFGSNMAYQVGRYHTARGADATLRLINKILSDDLSTRQ
FT                   VADIVKGRASAQESTKPAGRQRYAQRLEIKLDGVSVGDLKSYGDDRIELRLKGLTREKR
FT                   DDILRQIEKMLK"
     atgaaaccct cccaattcgc caaaggcttt caagcacgtc ctgattcgac cagcagcgaa        60
     aagcgaaccg cactcgatcg cttgaacgca atcgacggta tcgtcaagaa cgacgccagg       120
     catagcgagg cggcggggcg cgtcatcgcg cccggcacgc cgtcgcagag cctcacggaa       180
     gtcgatgccg tcgatgcggc caatgaatca gcggcctacc gcacatggcg gctcgagcac       240
     ggctaccggc ctggtcaggt catcgagctg gcgctcaaaa cgatcaagcc gagcccgttc       300
     aacccgcggc acttctatct gaagtcgtcg atcgccgaac tcgcggtcaa ccttgccaag       360
     cagggacagc agcaagcaat ccacgtcatt ccggattacg acaatcccgg cacctacttc       420
     gtcagcgatg gcggacggcg cgtgcgagca ttgaaagaag ccaacaagga atcggtgaag       480
     gcgatcgtcg tcgatctgcc gatcggcatt cagagctaca agcttggcta cgacctcaac       540
     gtccaacgtg attcacagac cgtgttcgac aatgcggtcg tatggagacg cttcctcgat       600
     gaccggcact tccagagcca gaaggaactc gccgaacacc tcgggctgga cgagtcgacc       660
     gttgcagttg ccttgtcgat ttccaaattg cccgaggtcg tgatgcacga gatggttgcg       720
     agacccgatc gcttcggctc gaacatggcc tatcaggtcg gccgttacca cactgcccgc       780
     ggtgctgacg caacgctgcg cctgatcaac aaaatcctct ccgacgatct gagcacgcgc       840
     caggttgcgg acatcgtcaa gggaagagcg agcgcccagg aaagtaccaa acccgccgga       900
     cggcaacgct acgcgcaacg cctggaaatc aaactcgacg gcgtgtcggt aggcgatctc       960
     aagtcgtacg gggatgatcg aatcgaactg cgcctgaagg gtctcacgcg tgaaaagcgc      1020
     gacgatatcc ttcggcagat tgaaaaaatg ttgaagtag                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page