(data stored in SCRATCH zone)

EMBL: CP000271.PE20

CP000271.PE20        Location/Qualifiers
FT   CDS_pept        21800..22342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32988"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF1"
FT                   /protein_id="ABE32988.1"
FT                   /translation="MISAHAKDSFDRIFRKAAQARLPLDAGDLCEIAPIADAGIGVSRD
FT                   TQVVVLTISSIVFRLLLILHFDEDGSTRAYYLKDAADERPFQEVFLEICNLCCGAMNQE
FT                   LLRYFPDLGMSTPYVLNARCLPHLHELKPGLLSSYSVTLNGTVRLAATVCVCADAPLDF
FT                   VADTSALEETGGELELF"
     gtgatctcgg cccacgccaa ggacagcttc gaccgtattt tccgcaaggc cgcccaagcg        60
     cgtttgccgc tggatgccgg cgatctgtgc gagatcgcgc cgattgccga cgccggcatt       120
     ggcgtatcca gagacacgca agtggtcgtg ctgaccattt cgtcgatcgt gttcagactg       180
     ctgctgattc tccatttcga cgaagacggg agcacgcgcg cttactacct caaagacgcc       240
     gccgacgagc ggccgttcca ggaagtcttt ctggaaatct gcaacctgtg ttgcggcgcg       300
     atgaatcagg agttgttgcg ctactttccg gacctcggca tgtcgacgcc ttatgtgctg       360
     aacgcgcgtt gcctgccgca tctgcatgaa ttgaagccgg gtttgctgtc gtcgtattcg       420
     gtcacgctga acggcactgt gcggcttgcc gcgaccgtat gcgtatgcgc cgatgcgccg       480
     ctcgacttcg tcgccgacac gagcgcgctc gaagaaaccg gcggcgagct ggaattattt       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page