(data stored in SCRATCH zone)

EMBL: CP000271.PE203

CP000271.PE203       Location/Qualifiers
FT   CDS_pept        239890..241107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2824"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2824"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33171"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW8"
FT                   /protein_id="ABE33171.1"
FT                   /translation="MESFDIAVIGAGAAGMMCAAVAGQLGRRVVLIDHSQRLAEKIRIS
FT                   GGGRCNFTNLYAGPANYLSANPHFCRSALARYTPRDFMALLKRHHVTWHEKHKGQLFCD
FT                   QSSDAVINVLKSECDAGRVAWRTPLSVEQVRQDAAGRFALDTRSGPITARALVIATGGL
FT                   SIPKIGATDFAYRLARQFGHKLIDTRPALVPLTFAAADWEPFSALSGVSLEVQLATGNK
FT                   KTGAEFNEDLLLTHRGLSGPGVLQISSYWQPGEPIHINLLPEQDATTALLEAKTGTKRQ
FT                   IGNLLSEWVPQRLAHVWLEAHQVPAEARVADLPDKTLRRVGEALSRWTLTPNGTEGYRK
FT                   AEVTRGGVDTRELSSSTMMSARAPGLYFIGEAVDVTGWLGGYNFQWAWASGVAAGQAAA
FT                   EYVQGA"
     atggaatcct tcgatatcgc agtgatcggc gcgggcgcgg ccggcatgat gtgcgcggcc        60
     gtggccgggc agctcggccg ccgcgtggtg ctgatcgacc attcgcagcg tctcgcggag       120
     aaaatccgca tctccggcgg cggccgctgc aacttcacga atctgtatgc cgggccggcc       180
     aactacctgt cggccaaccc gcatttttgc cgctcggcac ttgcgcgcta cacgccgcgc       240
     gacttcatgg cgctgctcaa gcgccatcat gtgacgtggc atgagaagca caaaggccag       300
     ctattctgcg accagtcgag cgacgcggtc atcaacgtgc tgaagagcga gtgcgacgcg       360
     ggccgcgtgg catggcgcac acctttgtcc gttgaacagg tgcggcagga cgcggccggc       420
     cggttcgcgc tggatacccg gtcggggccg atcactgcac gcgcgctcgt gatcgcgacc       480
     ggcggccttt ccattcccaa gatcggcgcc acggattttg cttaccgact tgccaggcaa       540
     ttcggtcaca agctgatcga tacgcgcccc gcgctggttc cgctgacctt cgccgcggcc       600
     gactgggagc cgttctcggc gctgtctggt gtctcgctcg aagtgcaact cgcgaccggc       660
     aacaagaaga ctggcgccga attcaacgaa gatctgctgc tgacccaccg cggcctttcc       720
     ggtccgggtg tattgcagat ttcgagctac tggcagcccg gcgagccgat tcacatcaac       780
     ctgttgcccg agcaggacgc cacgaccgcg ctgctggaag ccaaaaccgg cacgaagcgc       840
     cagatcggca atctgttgtc ggagtgggtg ccgcagcggc tcgcccatgt ctggctggaa       900
     gctcatcagg ttccggccga agcccgcgtg gctgacttgc cggataaaac cctgcgccgg       960
     gtcggcgagg ctctgtcgcg ctggacgctc acccccaacg gcacggaggg ctatcgcaag      1020
     gccgaagtga cgcgcggtgg tgtcgatacg cgcgagctgt cgtcatcgac gatgatgagc      1080
     gcgcgcgccc cgggcttgta cttcatcggc gaggcggtgg acgtgaccgg ctggctcggc      1140
     ggctataact tccagtgggc gtgggcatcc ggcgtggcgg ctggtcaggc cgccgcggag      1200
     tatgtccagg gggcttga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page