(data stored in SCRATCH zone)

EMBL: CP000271.PE205

CP000271.PE205       Location/Qualifiers
FT   CDS_pept        241638..242084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2822"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2822"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33173"
FT                   /db_xref="GOA:Q13RW6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW6"
FT                   /protein_id="ABE33173.1"
FT                   /translation="MSLKDRINDDMKAAMRARETERLGTVRLLLAAIKQREVDERITLD
FT                   DTAITAVIDKMIKQRKDSISQFEAAGRTDLADKEKAELAILSAYMPEQMSEAEIVAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKPKLAGRADMTAVSAQVKAALAK"
     atgagtctca aggaccggat caacgacgat atgaaggccg ccatgcgggc acgtgaaacc        60
     gagcgtctcg gcacggtccg cctgttgctc gccgcgatca agcagcgcga agtcgacgag       120
     cgcatcacgc tcgacgacac cgcgatcacc gctgtgatcg acaagatgat caagcagcgc       180
     aaagactcga tcagccagtt cgaagcggct ggccgcacgg atctggccga caaggaaaag       240
     gccgaactgg cgatcctgtc tgcctatatg ccggagcaga tgtccgaggc cgagatcgtt       300
     gccgaagttc aggcggcggt cgcgcaaacc ggcgcggccg gcccgcagga catgggcaag       360
     gtgatgggcg tgctcaagcc gaagctggcc ggccgcgccg acatgaccgc cgtctcggcg       420
     caggtcaaag ccgcgctcgc gaagtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page