(data stored in SCRATCH zone)

EMBL: CP000271.PE207

CP000271.PE207       Location/Qualifiers
FT   CDS_pept        244486..246528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2820"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33175"
FT                   /db_xref="GOA:Q13RW4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW4"
FT                   /protein_id="ABE33175.1"
FT                   /translation="MTKKLNEVPVDDDATQSEENPAAVPAKVEKAKARDRRAKEKALLK
FT                   DAFASSQPGTVEELEERRSKLRALIKLGKERGFLTYAEINDHLPDNFTETEAIEGIIST
FT                   FNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEDGLKHMVMAISACPTTIADILAMAERVANEEIRIDEL
FT                   VDGLIDANAEDADGFSAQEAEAIESEDEEVEEDSEEDEEEDDGTAQATANAAQMEALKR
FT                   ASLEKFAMISEWFDKMRRAFEKEGYKSKSYLKAQETIQNELMTIRFTARTVERLCDTLR
FT                   AQVDEVRQVERQILHTVVDKCGMPRAEFIARFPGSETDLEWADKIVGEGHAYSAILTRN
FT                   IPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAK
FT                   KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
FT                   IPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETP
FT                   IGDDDDSHLGDFIEDNNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMST
FT                   DHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
     atgacgaaaa agctgaacga agtacccgtc gatgacgacg caacccaaag cgaagaaaac        60
     cctgcggctg ttccagccaa ggtggaaaag gccaaggctc gcgaccgtcg ggcaaaggaa       120
     aaagcgctgc tgaaagacgc tttcgcgtcg tcacagcctg gcacggtcga ggaactcgag       180
     gagcgccgct ccaaactgcg cgcgctaatc aagctcggca aggagcgcgg cttcctcacg       240
     tacgcagaaa tcaacgacca ccttccggac aacttcaccg agaccgaggc gatcgaaggc       300
     atcatcagca cgttcaacga catgggcgtg gctgtgtacg agcaggcccc ggacgctgaa       360
     acactgctgc tgaacgacaa cgcgccggcg gcttcttcgg acgacgaagt ggaagaggaa       420
     gcggaagtcg cgctgtccac cgtcgactcg gaattcggcc gcaccacaga cccggtccgc       480
     atgtacatgc gggaaatggg cacggtcgaa ctgctcacgc gcgaaggcga aatcgaaatc       540
     gccaagcgga tcgaagatgg cctgaagcac atggtgatgg ccatctccgc gtgcccgacc       600
     acgatcgccg acattctggc aatggccgag cgcgtcgcga atgaggaaat tcgcatcgac       660
     gaactggtcg acggcctgat cgacgccaac gcggaagacg cggacggctt ctccgcgcaa       720
     gaagcggaag cgatcgaaag cgaagacgaa gaggtcgaag aggactcgga agaggacgag       780
     gaagaagacg acggcacggc gcaagccacg gccaacgccg cgcagatgga agcgctcaag       840
     cgtgcgtcgc tcgaaaaatt cgcgatgatc agcgaatggt tcgacaagat gcgtcgcgcg       900
     ttcgagaaag aaggctacaa gtccaagtcg tatctgaagg cgcaggaaac gatccagaac       960
     gagctcatga cgatccgctt taccgcgcgc accgtcgagc gtctgtgcga cacgctgcgc      1020
     gcgcaggtgg acgaagtgcg tcaggtcgag cgtcagattc tgcacacggt agtcgacaag      1080
     tgcggcatgc cgcgtgcgga attcattgcg cgtttcccgg gcagcgagac ggatctcgag      1140
     tgggccgaca agatcgtcgg tgaaggtcac gcgtatagcg cgatcctcac gcggaacatt      1200
     ccggctattc gcgaacagca gcagcgtctg ctggatctgc aggcgcgcgt cgtgctgccg      1260
     ctgaaggacc tgaaggaaac caaccgtcag atggcggcgg gcgaactgaa ggcgcgtcag      1320
     gcaaagcgcg agatgaccga ggcgaacttg cgtctcgtga tctcgatcgc gaagaagtac      1380
     acgaaccgtg gtctgcagtt cctcgacctg attcaggaag gcaacatcgg cctgatgaag      1440
     gcagtggaca agttcgaata tcgtcgcggc tacaagttct ccacgtatgc aacgtggtgg      1500
     atccgtcagg ccattacgcg ttcgatcgcg gaccaggcgc gcacgatccg gattccggtt      1560
     cacatgatcg aaacgatcaa caagatgaac cgcatctcgc gtcagatctt gcaggaaacc      1620
     ggtctcgagc cggatccggc aacgttggcc gagaagatgg aaatgccgga agacaagatc      1680
     cgcaagatca tgaagatcgc gaaggaaccg atctcgatgg aaacgccgat cggtgacgac      1740
     gacgattcac atctgggcga tttcatcgaa gataacaaca cggttgcgcc ggccgacgcc      1800
     gccttgcacg ccagcatgcg cgacgtcgtg aaagacgtgc tcgactcgct gacgccgcgt      1860
     gaagcgaagg tgctgcgcat gcgtttcggt attgagatga gcaccgatca cacgctcgaa      1920
     gaagtcggca agcagttcga cgtgacgcgt gaacggatcc gtcagatcga ggcaaaggcg      1980
     ctgcgcaagc tgcgccaccc gagccgttcg gacaagctga agtcgttcct cgaagggaat      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page