(data stored in SCRATCH zone)

EMBL: CP000271.PE209

CP000271.PE209       Location/Qualifiers
FT   CDS_pept        248627..249043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2818"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2818"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33177"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RW2"
FT                   /protein_id="ABE33177.1"
FT                   /translation="MSEQRSATAKTIGVTGRYLVESRGNFFASDSPSARDGETAAVEPS
FT                   ELLLSALGVCALGSVEKAAREFELNVRHADATVDSLRDPDDRTRFARVHIEVTVYGVTQ
FT                   PQAQRLIDHFTSGCVIYNTVRRAGPISVAVTAHP"
     atgagcgaac agcgcagcgc aaccgcaaaa accatcggcg tgaccggccg ctatctggtc        60
     gaaagccgcg gaaatttctt cgcctccgat tcgccctccg cgcgcgacgg cgagacggcg       120
     gcagtggagc cttcggagct tctgctctcg gcgctcggcg tgtgcgcact cggcagcgtc       180
     gaaaaggccg cgcgggaatt cgagttgaac gtgcgccatg ccgatgccac ggtcgattcg       240
     ctgcgcgacc ctgacgaccg tactcgcttt gcccgcgtgc atatcgaggt gacggtatac       300
     ggcgtgacgc agccccaagc gcagcggctg atcgaccatt tcacgagcgg ctgcgtgatc       360
     tacaacacgg tgcgccgcgc cggcccgatt tccgtcgcag tcacggctca tccctaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page