(data stored in ACNUC7421 zone)

EMBL: CP000271.PE21

CP000271.PE21        Location/Qualifiers
FT   CDS_pept        22380..23351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32989"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF0"
FT                   /protein_id="ABE32989.1"
FT                   /translation="MNMNKPVSKVLVLDDCPAHKEALKRFCDENNLVGVKVGKNRLQSV
FT                   LRSNIDLGAVLFAERYGGSPEASAEIAIRINAVRPELPIIMRRDNDPGMDDLPEGLQRV
FT                   VCAAYVAHDMAPLRQVIDEYIFSLDYPNALVRGIADMTQAILGDVFKDLTITCDTPHIV
FT                   RDRIIFGEVFSLIPLESAWCRGYMMMQAEETPILDLLDRHQMIDNTQRGEADFRDLNSV
FT                   LGEVTNLIWGSFRNRYVGDADAWARSQVQVPLLVNHKHKYISFGSGNPQLCFTYWLKDP
FT                   KSNRAVKLHQRFVFSLSWSPEDFTEVADDVGAMVEAGELDLF"
     atgaacatga acaaaccggt cagcaaggtg ctggtgctgg atgattgccc ggctcacaaa        60
     gaagcgctga agcgcttttg cgacgagaac aacctggtcg gcgtgaaagt cggcaagaac       120
     cgcctgcagt cggtcctgcg ctcgaatatc gatctgggcg cggtgttgtt cgccgagcgt       180
     tacggcggct cgccggaagc cagcgccgag atcgcgatca ggatcaacgc ggtgcgcccc       240
     gagttgccga tcatcatgcg ccgggacaac gaccccggca tggacgactt gccggagggc       300
     ttgcaacgcg tggtgtgcgc cgcgtatgtc gcgcacgata tggcgccgct gcgtcaggtg       360
     atcgacgagt acatcttcag cctggattat ccgaacgcgc tggtgcgcgg tatcgccgac       420
     atgacacaag ccattctcgg cgacgtgttc aaggatctga ccattacgtg cgacacgccg       480
     catatcgtgc gcgaccgcat tatcttcggc gaggtgttca gtctgattcc gctggaaagc       540
     gcgtggtgcc gcggctacat gatgatgcag gccgaagaga cgccgatcct cgacctgctc       600
     gatcgtcacc agatgatcga taacacgcag cgcggcgagg cggatttccg cgatctcaac       660
     agcgtgctcg gcgaagtgac gaatctgatc tggggttcct tccggaaccg ctacgtaggc       720
     gatgcggatg cctgggcacg cagccaggtc caggtgccgc tgctggtgaa tcacaagcac       780
     aagtacatct cgttcggcag cggcaatccg caattgtgct tcacgtactg gctgaaagac       840
     ccgaagtcga accgggcggt caagttgcat caacgttttg tgttcagcct gagctggtcg       900
     ccggaggact tcacggaagt cgcggacgac gtcggcgcaa tggtcgaggc aggcgaactg       960
     gatctgttct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page