(data stored in ACNUC7421 zone)

EMBL: CP000271.PE215

CP000271.PE215       Location/Qualifiers
FT   CDS_pept        253988..254422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2812"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2812"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33183"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV6"
FT                   /protein_id="ABE33183.1"
FT                   /translation="MLEIQRLSVAEAAILLEGARLKATELAIPMCTAVTDESGHLITFE
FT                   RMDGGKISSISIAIDKAFTGAVARKGTHVYNQLCVPGKGTFGIHVTNGGHFSIIGGGLP
FT                   VTVNGAIVGGVGVSSGTADEDLIVAEAAVAWFRERTGFAE"
     atgcttgaaa tccaacgact ttcggtcgcc gaagcggcca tcctgctcga aggcgcgcgc        60
     ctgaaagcca ctgaacttgc cattccgatg tgcaccgctg tgaccgacga atcgggccac       120
     ctcatcacgt tcgagcggat ggacggcggc aagatcagca gtatcagcat cgcgatcgac       180
     aaagcgttca cgggcgctgt cgcgcgcaag ggcacgcacg tctacaacca gctctgcgtg       240
     ccgggcaagg gcacgttcgg tatccacgtc acgaacggcg ggcacttcag catcatcggc       300
     ggcggtctgc cggtgacggt gaacggcgcg atcgtcggcg gcgtgggtgt gagttcagga       360
     accgcggacg aagacctgat cgtggccgaa gcggccgtgg cctggttccg cgaacggacc       420
     ggcttcgcgg agtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page