(data stored in SCRATCH zone)

EMBL: CP000271.PE219

CP000271.PE219       Location/Qualifiers
FT   CDS_pept        257670..258887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2808"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33187"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV2"
FT                   /protein_id="ABE33187.1"
FT                   /translation="MLKEQIAATLLGLARIAAVAAATVSMAQAAQAAEAPYKLGYLVDA
FT                   SGPQSTTLKPTFDAFQLYIAQLNRAGGVNGRQVQIITRDIQSDTQRSLNAVEQLRSESV
FT                   SAVLGLGATNTHAPVYAAAQKLGLPVLASNPINIPIVLPPVKPYAFGLGQELTLAGIIG
FT                   GHFAHRLRPQGKTIACVAFEVPGSILSCNKILEQAKAEGYQRGELYTVPISQRDFRAVV
FT                   DRIVSLNPDVVADCIGREHLAALLPVLAASAYSGIFLSMDTGIGDKTLIDAVPANSKLQ
FT                   VYSFTRFVTHGDGAGPQASALRTALAAAHMPDDDASYAGGWALGLVVTDALRRCRGACG
FT                   PDALRAALENVDIDSGGLTGARLTFTPNDHYGPSAWRLYRYDAAGKSLSAVGGWQRIAS
FT                   DGKLTP"
     atgctaaaag aacagattgc cgcgaccctg cttgggctcg cgcggatcgc ggccgttgcg        60
     gccgcaacgg tatcgatggc gcaggcggcg caagcggccg aagcacccta caagctcggc       120
     tatcttgtcg acgcatcggg gccgcaatcc accacgctca aacccacgtt cgacgcgttc       180
     cagctctata tcgcgcaact gaatcgcgca ggcggcgtca acgggcggca ggtgcagatc       240
     atcacacgcg atatccagag cgacacgcag cgttcgctca acgcggtcga gcagctcagg       300
     agcgagagcg tttcggcggt gctcggcctt ggcgcgacga acacgcacgc gcccgtatac       360
     gcggcggcgc agaagctcgg cctgcccgtg ctcgcgtcga atccgatcaa cattccgatc       420
     gtgcttccgc cggtcaagcc ctatgcgttc gggctcggcc aggagttgac cctcgcgggc       480
     ataatcggcg ggcactttgc gcaccggttg cggccgcagg gcaagaccat cgcgtgcgtg       540
     gcattcgaag tgccgggctc gattctgagc tgcaacaaga tcctcgaaca ggcaaaggcc       600
     gaaggctatc agcgcggcga gctctatacg gtgcccatca gccagcgcga ttttcgcgcg       660
     gtcgtcgaca ggatcgtgtc gctgaatcct gacgtcgtgg ccgactgcat cggccgcgaa       720
     catcttgccg cgctgctgcc ggtgctggcc gcttccgcat atagcggcat ctttctctcg       780
     atggacaccg gcatcggcga caagacgctg atcgatgccg ttccggcgaa ctcgaaactt       840
     caggtctaca gcttcacgcg tttcgtgacg catggcgacg gcgccggtcc gcaggcgagc       900
     gcgctgcgca ccgcgctcgc cgctgcccac atgcccgacg acgacgcgag ttacgcgggc       960
     ggctgggcac tggggctcgt cgtgaccgat gcgctgcgcc gttgccgggg cgcgtgcggc      1020
     cccgatgcgc tgcgggccgc gctggagaac gtggacatcg acagcggcgg tctcacgggc      1080
     gcgcgtctca ccttcacgcc gaacgaccac tatggaccgt ccgcgtggcg tctgtatcgc      1140
     tacgacgcag cgggcaagtc tctctccgcg gtgggcggct ggcagcgcat tgcgagcgac      1200
     ggcaagctca cgccctga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page