(data stored in SCRATCH zone)

EMBL: CP000271.PE22

CP000271.PE22        Location/Qualifiers
FT   CDS_pept        23372..23737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3007"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32990"
FT                   /db_xref="GOA:Q13SE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE9"
FT                   /protein_id="ABE32990.1"
FT                   /translation="MSKILVVDDSSTVRDEVAGFLKKNGLDVDTAVDGKDGLAKLKASP
FT                   GIKLVISDVNMPNMDGLTMVEKIRGELANKTVNVIMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLETFRKLAG"
     atgtcgaaaa ttctggtggt ggatgattcg agcacggtgc gcgacgaagt ggccggcttt        60
     ctcaagaaaa acggtctgga cgtcgacacg gcggtggacg gcaaggacgg cctcgccaag       120
     ctgaaggcca gccccggtat caagctggtg atcagcgacg tcaacatgcc gaatatggac       180
     ggcctgacga tggtcgagaa gattcgcggc gagctcgcga acaagaccgt caacgtcatc       240
     atgctgacga ccgagagcag cccggcgatg aaggagcgcg gcaaggcggc cggcgtcaag       300
     ggatggatcg tcaagccgtt caagggcgac gcagtgctgg aaacgtttcg caaactggcg       360
     ggctag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page