(data stored in ACNUC7421 zone)

EMBL: CP000271.PE221

CP000271.PE221       Location/Qualifiers
FT   CDS_pept        259779..260810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2806"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2806"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33189"
FT                   /db_xref="GOA:Q13RV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RV0"
FT                   /protein_id="ABE33189.1"
FT                   /translation="MSSLQSGALEPHTRTIFPRGAVQPALLAVAIAALAAPFALGGYGL
FT                   YIASSGGVMALGAMALTVLSGSAGLPSLGTAAFMAIGAFSAGILATQWGLGMLPALLLA
FT                   LVLGFAAGAGVALLTLRVSGLYLAVGTLALQHVVQIVATDLDLKFTYASGFMLESPHIA
FT                   GLAIDTPAKWWGMTIVLLLGVYVLFRSLQRGHVGREWALLRTEPTAAATLGVSPVRARL
FT                   TVFALTSAVIAASGAIDGYRLGNVQATGYSLHLAIMYLTVVALGGAGRLVGAVVASYAI
FT                   VVLPDAIAAVLATLGIDATTRLAGIDNMLLGALLVCALLDLPARARRAILRPGAASAAR
FT                   REP"
     atgtcgagtc ttcaatcagg tgcgctggaa ccgcatacac gcacgatctt tcctcgcggc        60
     gccgtgcagc ccgcgctgct cgcggtggcg atcgcggcac tcgccgcgcc gttcgcgctg       120
     ggcggctatg ggctttacat tgcatccagc ggcggtgtga tggcgctcgg cgcgatggcg       180
     ctcacggtcc tttcggggtc cgcgggccta ccctcgctcg gcaccgccgc tttcatggca       240
     atcggcgcgt tttcggcggg cattcttgcg acgcaatggg gcttgggtat gctgccggcc       300
     cttctgctcg cgctcgttct cggcttcgcc gccggcgcgg gcgtcgcgtt gctcacgtta       360
     cgtgtttcgg ggctttatct ggcggtcggc acgctggcat tgcagcacgt cgtgcagatc       420
     gtcgcgaccg acctcgatct caagttcacc tacgcaagcg gcttcatgct cgagtcaccg       480
     catattgcgg gcctcgcgat cgatacaccg gcgaaatggt gggggatgac gatcgtgctt       540
     ctgctcggcg tctatgtgct gtttcgcagc ctccagcgcg gccatgtggg acgcgagtgg       600
     gctctccttc gcacggagcc gacggcggcc gcgacactgg gcgtttcgcc ggtgcgcgca       660
     cggctcacgg tctttgcgtt gacgtctgcg gtgatcgccg catcgggcgc catcgacgga       720
     taccggctgg gcaatgttca ggcgacgggc tattcgctgc atctggccat catgtatctc       780
     acggtcgtcg cgctcggcgg cgcgggcagg ctcgtgggcg ccgtggtcgc ctcgtatgcg       840
     atcgtcgtgc tgcccgacgc cattgcggcg gttctcgcca cgctgggtat cgacgccacc       900
     acgcgccttg cgggcatcga caacatgttg ctcggcgcgc tgctcgtctg tgcgttgctc       960
     gatcttccgg cgcgcgcgag gcgcgccatt ctgcgccccg gcgctgcatc cgccgcgcgg      1020
     agggaaccgt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page