(data stored in ACNUC7421 zone)

EMBL: CP000271.PE222

CP000271.PE222       Location/Qualifiers
FT   CDS_pept        260807..261580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2805"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2805"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33190"
FT                   /db_xref="GOA:Q13RU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU9"
FT                   /protein_id="ABE33190.1"
FT                   /translation="MTEAQLMEVRALSITYGVDRAVDHVSFAIARGTSLVLAGNNGAGK
FT                   TSVLGALAGLRLRGQRVSGEAVFGGVVLRMGDIAQRIRQGVRLVPDREKVFGLLSVADN
FT                   LRIGAARTRSNAIRLDDVLGWFPRLAERRGSLAGNLSGGEQQMLGIGMALLASPQLLLL
FT                   DEPTLGLAVPVIEDLCERLARLRREAGLTMLVAESDSQWLAALADTAAVLDRGRLLRTF
FT                   GTLSRGDLGTIHDLMLGLGANGDEADRPEDRHATV"
     gtgactgaag cgcagcttat ggaagtgcgc gcgctgtcga ttacgtacgg cgtggatcgc        60
     gcggtcgatc acgtctcgtt cgccattgcg cgcggtacga gtctggtgct cgcgggcaac       120
     aatggtgcgg gcaagacttc cgtgctcggc gcgctggcgg gtttacgcct gcgcggccaa       180
     cgtgtcagcg gagaagcggt gttcggcggc gtggtcttgc gtatgggcga tatcgcgcag       240
     cgcatcaggc agggtgtgcg cctcgtgccg gaccgtgaga aggtattcgg tttgctgagc       300
     gtcgcagaca atctgcggat cggcgctgcg cgcacgcgca gcaacgcgat tcgtctcgac       360
     gacgtactgg gatggtttcc gcgacttgcc gaacgcagag gttcgctcgc gggcaacctc       420
     tcgggcggcg agcagcagat gctcggcatc ggcatggctt tgctcgcctc gccgcaactg       480
     ctattgctcg atgaaccgac gctcgggctc gccgtgccgg tcatcgagga tctgtgcgaa       540
     cggctcgcgc gtttgcgccg cgaagccggt cttacgatgc tcgtcgcgga gtccgattcg       600
     caatggcttg ccgcgctcgc cgacactgcc gccgtgctgg atcgcggacg tctgctgcgt       660
     acgttcggca cgttgtcacg gggcgatctc ggcacgatcc acgatctcat gctgggactt       720
     ggcgcgaacg gcgatgaagc cgatcgcccg gaggatcgcc atgcaacggt ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page