(data stored in ACNUC7421 zone)

EMBL: CP000271.PE223

CP000271.PE223       Location/Qualifiers
FT   CDS_pept        261567..262358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2804"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2804"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33191"
FT                   /db_xref="GOA:Q13RU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU8"
FT                   /protein_id="ABE33191.1"
FT                   /translation="MQRSDPSIVLSLQRVNLSFGGLQVLRDVELCLQAGEVLALIGPNG
FT                   AGKSALLNCITGVYRPAAGSEIRLHDTRIDGLAPHRVARLGIGRTFQGLKLLRERTVLD
FT                   NILLGWTTRFSLGALGSLARPWRARREEREARERVYAMAELCGLAELRDVYCGELPLGV
FT                   LRRVDLARALLRDPDVLLLDEPASGLSHDERPLIGELVRIACQDAKRSVVWIEHDLDLV
FT                   LTEAHRAVVLHHGTVVTSDNPAQPSGRARLLTAYRKGRLTA"
     atgcaacggt ctgatccgtc gattgtattg agcctccagc gcgtgaatct ctcgttcggc        60
     gggcttcagg tgctgcgcga cgtcgaattg tgcctgcagg ccggggaagt gcttgcgctg       120
     atcggcccga acggcgcggg caagtccgcg ctgctcaact gcatcacggg tgtctaccgt       180
     ccggcggcag gcagcgagat acggctgcac gacacgcgta tcgacggcct cgcgccgcat       240
     cgtgtcgcga gactcggtat tgggcgtacg tttcagggac tcaagctcct gcgtgagcgc       300
     acagtgctcg acaacattct gctcggctgg acgacgcggt tttcgctcgg cgcactgggc       360
     agcctcgcgc ggccgtggcg cgcgcgtcgc gaggagcgcg aggcccgcga gcgagtgtat       420
     gcgatggccg agctatgcgg tctcgccgaa ctgcgcgatg tgtactgcgg cgagcttcca       480
     cttggcgtgc tgcgtcgcgt cgatctggcg cgcgcgttgt tgcgcgatcc ggacgtcctg       540
     ttgctggacg agcccgcctc cgggctcagc cacgatgaga ggccgttgat cggcgaactg       600
     gtgcgcattg cgtgccagga cgcaaaacgg tctgtcgtat ggatcgagca cgatctcgac       660
     ctcgtattga ccgaagcgca ccgcgccgtg gtgctgcatc acggcacggt ggtgacttcc       720
     gataaccccg ctcaaccttc cggccgcgcg cgtctgctga cggcttaccg gaaagggcgg       780
     ttgacggcgt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page