(data stored in ACNUC7421 zone)

EMBL: CP000271.PE226

CP000271.PE226       Location/Qualifiers
FT   CDS_pept        complement(264292..264858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33194"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU5"
FT                   /protein_id="ABE33194.1"
FT                   /translation="MRSHTINLLDNKEHDSMRNLHPHAMDLNGYPGNRTRPMRHAAWRI
FT                   GLRVWGFAESEVNAWIRDLPVLDGSLCWEIAHQRDGSGADMIIHLVRSSSPALGSFCWN
FT                   SVGANDAIRASRWSSRVEMALFSGDVTRLPQVRYGLWAMAGTRPAESALHTLAQAVIVP
FT                   QFLRRRVTQGTGAVRVVPRRLALVR"
     atgcgaagcc acactatcaa cctactggac aacaaggagc acgacagtat gcgaaacctc        60
     catccccatg caatggatct caacggatat cccggcaatc gaaccaggcc aatgcgccac       120
     gcagcgtggc gcattggcct gcgcgtgtgg ggctttgcgg agtccgaggt caacgcatgg       180
     atacgggacc ttccggtgct ggatgggtcg ctatgctggg agatcgccca ccaacgcgac       240
     ggcagcggcg cggacatgat cattcatctg gtcaggtcgt cgtctcccgc gttgggatct       300
     ttttgctgga acagcgtggg tgccaacgac gccattcggg cgtccaggtg gtcatcgcgt       360
     gtggaaatgg ctttgttttc cggcgatgtg acccgtttgc cgcaggttcg atacggacta       420
     tgggcgatgg ccggaacacg ccccgcagaa tcggcgcttc atacgctggc tcaggctgtt       480
     attgttccgc agtttctgcg taggcgcgtg acgcagggaa ctggcgcggt ccgcgtggtg       540
     ccgcgccggc tcgcattggt caggtag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page