(data stored in ACNUC7421 zone)

EMBL: CP000271.PE228

CP000271.PE228       Location/Qualifiers
FT   CDS_pept        266423..267271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2799"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2799"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33196"
FT                   /db_xref="GOA:Q13RU3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU3"
FT                   /protein_id="ABE33196.1"
FT                   /translation="MAILDIEVISMQEERLQQAVAWLREADGLLITAGAGMGVDSGLPD
FT                   FRGNEGLWRAYPALAEAGCDFQSIANPRAFMDKPELAWGFYGHRLKLYREVEPHPGFAI
FT                   LRRWGDRLRQGAFVFTSNVDGQFQRAGFAESRIEECHGSIHYLQCTEPCFSLIESATDF
FT                   VPSIDERECRCIGPLPRCKRCGAISRPNILMFWDSAWLSSRADAQAARLAGWLRTVERL
FT                   VVVEVGAGTALPTVRRFSERHGPRVIRINAREAQIDPARGVGIEGRAVEILTAIDSGLD
FT                   V"
     atggcgattc tggatatcga ggtgatttca atgcaggaag aacggctaca gcaagcggtc        60
     gcatggctgc gcgaagcaga cgggttgctg atcaccgcgg gagcggggat gggcgtcgac       120
     tcaggtctgc ccgattttcg gggcaatgaa ggcttgtggc gcgcctaccc cgcgctggcc       180
     gaggcagggt gcgatttcca atccatcgcc aacccgcgcg ccttcatgga taagccagaa       240
     ttggcctggg ggttctatgg acaccgcctg aagctttatc gcgaggtcga acctcatccg       300
     ggctttgcca ttctcaggcg ctggggcgac cgcctgcgtc agggcgcctt tgttttcacg       360
     agcaatgtgg atgggcaatt ccaacgggcg ggatttgcgg aaagccggat cgaggaatgc       420
     cacggctcga ttcactatct gcagtgcacg gagccgtgtt tttcgctaat cgagtcggct       480
     acggacttcg tgccgagcat tgatgaacgc gaatgccggt gcattggtcc gttaccgcgc       540
     tgcaaacgct gcggggcgat ttcgaggccg aatatcctga tgttctggga ctcggcgtgg       600
     ctatcctccc gagccgatgc acaggccgca cgcctcgccg gctggctgag gacggtcgaa       660
     cggcttgttg tcgtcgaagt gggggccggc accgcattgc ctactgtgcg gcgtttcagc       720
     gaacggcacg gtccacgggt aatccgcatc aatgcgcgcg aagcacagat cgatccagca       780
     cgcggtgtcg gtatcgaggg acgggctgtg gagattttga cggcaattga cagcggcttg       840
     gacgtatag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page