(data stored in SCRATCH zone)

EMBL: CP000271.PE229

CP000271.PE229       Location/Qualifiers
FT   CDS_pept        267596..268354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2798"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33197"
FT                   /db_xref="GOA:Q13RU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU2"
FT                   /protein_id="ABE33197.1"
FT                   /translation="MQITDTQAMQIVGFRSAYAYPAAHLVLDDHAGDFGLPGGQWAKVV
FT                   TPAQGDVTDAALDAYHERLLRSANPTERLLGTASIVFWGFYTFGPAFAAIRVHRHLFGR
FT                   GNQQITRAEQIADVLEEADTAIKAGNPGAALGMFTGINQLSRTPFASKVVALLDPRRAA
FT                   VYDNRICKGLRSSPWAANGPFANGVGSVQLRRVQREYANWCSFTQAIAEQMNEGCSRGL
FT                   AWHWRDRRDAPQSWRAIDAERAIFAMFQPD"
     atgcagatca ccgacacgca agccatgcag atcgtcggtt tccgtagcgc atacgcctat        60
     ccggcagcac accttgtgct tgacgaccac gccggcgact tcgggttgcc gggcgggcag       120
     tgggcgaaag tcgtgacccc ggcgcaaggt gacgtcactg acgcggcgct ggatgcgtat       180
     cacgagcgcc tgctgcgttc tgcaaacccg accgaacgat tgctcggtac ggcgtcgata       240
     gttttttggg gattctatac atttggtccg gcattcgcgg ctatccgcgt tcaccgccat       300
     ctttttggcc gcggtaatca gcagataacc cgcgccgagc aaatcgcgga cgtactggaa       360
     gaggctgaca cagcgatcaa ggcgggaaat ccaggcgcgg cgctggggat gttcaccgga       420
     atcaaccagt tgagtcgcac gccgttcgcc tcgaaggtgg ttgcgctact ggaccccagg       480
     cgtgctgcgg tgtatgacaa cagaatctgc aagggcctgc ggagcagtcc ttgggcggcg       540
     aacggaccgt ttgcaaacgg cgtggggtcg gttcaacttc ggcgggtcca gcgcgaatat       600
     gcgaactggt gcagcttcac tcaggctatt gccgaacaga tgaacgaggg ttgctcgcgc       660
     ggacttgcgt ggcactggcg cgacaggcgg gatgccccgc agtcgtggcg cgccattgat       720
     gccgaacgtg ccatctttgc catgtttcaa ccggactga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page