(data stored in SCRATCH zone)

EMBL: CP000271.PE231

CP000271.PE231       Location/Qualifiers
FT   CDS_pept        complement(269720..270082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2796"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RU0"
FT                   /protein_id="ABE33199.1"
FT                   /translation="MLVFKRPAANGTLPGRHRNSSSQCGIQNQLIYKYAVQIKSELRSL
FT                   YLPYSYGIPHYLLETITPIHHGEKSKSTFWLRCIIHSPPHRKWRVTEKANMLADYYIRP
FT                   LHAGRIDGARSSAPCR"
     ttgttggtat tcaagcgccc ggcggcgaat ggaacccttc ccggtcgtca ccgcaactcg        60
     tcgtcgcaat gcggcataca aaaccagtta atctataaat atgcagtcca aattaaatcg       120
     gaattacgat cgctgtattt gccgtattcg tacggcatac cgcactatct gctagagacg       180
     atcaccccga tccatcatgg cgaaaagtcg aaaagtactt tctggttgcg gtgcatcata       240
     catagtccac cgcaccggaa atggcgggtg acggaaaaag ctaacatgtt ggcggattac       300
     tacattcggc cgttgcatgc aggccggatt gacggtgcgc gtagctcagc gccctgcaga       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page