(data stored in SCRATCH zone)

EMBL: CP000271.PE232

CP000271.PE232       Location/Qualifiers
FT   CDS_pept        270091..272469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2795"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33200"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT9"
FT                   /protein_id="ABE33200.1"
FT                   /translation="MGGNLFGHEPRVGRKTLALAAALSFSTSAHAVDPALNALGQAGGL
FT                   VIPYGFALPQGVGEVQYNDFIDPRYGKAATGSQIYWGAVGLFPYVELSGGLANYPANVG
FT                   VPLSHEEHFVLRHLMADVKLEVPKFFKYQPSIAFGVTDIGGQTHFFRSKYGVVSQAFGP
FT                   VTLTAGYGQGDRLDGLFGGAQVSLWNTGLSLLAEDDSRTPYAGVRYQSPRISWLADANV
FT                   IGTFMRSIRSTDGVSPRTSFSVAIQIPLGRRFSSTRCADGLCEGPQLPATQTANADDGG
FT                   PIRLASLQPVNTRAAAGNGGALAAAPITYVPPLQSYASVMLSDVTAAGSPDVRSPVVPE
FT                   ALNASALDEIAAQLFAAGLERVRVGMSGRDLVVEYENHRYNQNEADALGIVLGVASMNA
FT                   PHGTNRIHVVIKKANEPLGEVIVDRDAFAQFVEGGAPTAASTSLTMRTRPTYDADSIAW
FT                   HGNEHTHGLTRIQIEPIVSYLYGTEYGNFDISLGANIQGFVPLWRGAELYASYIAPIYN
FT                   TKNMDEGRVFSDYRLRGGLNAVALAQSFWIMPRVFNVASVGKFDYSYVGVQNETTVFVP
FT                   GRPDLIRLRLAYLHHEPGHDELPGEKNAELTYRWVQPSWKLWIEAGVARFVGGDKGPVA
FT                   TITRWFDDVSVSVHGEHSGQGTFVGAAISFPLTLRQGMKPGISQVYGAEQFGLDFRTRV
FT                   GSTNFLSPNAAENMTFPYSTQQYLLNQGRFSGEYFSTQLYRMRDAYLRYGRPGSDETKP
FT                   KQQVSAPAISAGSTLSRRLCGRGLQGVDDGPALAPVNCE"
     atgggcggaa atttgtttgg gcacgaaccg agagtaggcc gcaagacact ggcgttggct        60
     gccgcgctgt cgttttcgac ttccgcgcat gcggtggatc cggcgctgaa cgcgctaggg       120
     caggccggtg gtctggttat tccatatgga tttgcgttgc cccaaggtgt gggtgaagtg       180
     caatacaacg acttcatcga cccgcgatac gggaaggccg cgaccggatc ccagatctac       240
     tggggcgctg ttggcctgtt tccgtatgtc gagttgtcag gcggactggc aaactatccg       300
     gcgaatgttg gcgttccgct gtcgcatgag gagcatttcg tacttcgtca cctgatggct       360
     gacgtcaagc tcgaagtacc aaagttcttc aagtatcagc cgagtatcgc attcggcgtc       420
     acggacattg gcggccagac gcatttcttc cgttcgaaat atggcgtggt atcgcaagcg       480
     ttcgggcccg tgacactgac tgcgggttac ggtcagggcg accgtcttga tgggttgttc       540
     ggcggcgcac aggtctcgct atggaacacg ggattgtcgc tacttgcaga agacgattca       600
     aggacccctt atgccggtgt gcgctatcag tctccgcgga tcagctggtt agccgacgcg       660
     aacgtgatcg gcacgttcat gcgttcgatc cgctcgacag atggcgtatc gccgcgtacg       720
     tcgttctcgg tagccattca gattccgctt gggagacgtt ttagcagtac gcgttgtgca       780
     gacggcttgt gcgagggtcc gcagttaccg gccactcaga ccgcgaatgc cgacgatggc       840
     ggcccgatcc gcctcgccag cctgcaaccg gtaaatacgc gcgctgccgc gggtaacggc       900
     ggcgcattag ccgcagcgcc gattacgtat gtgccgccgc tgcagtcgta tgcgtctgtg       960
     atgctgagtg acgtgacggc ggccggatcg ccggatgtgc ggtcccccgt tgttccggaa      1020
     gccctgaacg cctccgcgct cgacgaaatc gcggcgcagc tctttgccgc cgggctcgag      1080
     cgcgtgcgcg tcgggatgag cggtcgcgat ctggttgtcg agtacgagaa ccatcgctac      1140
     aaccagaacg aagcagacgc actcggtatc gtgcttggcg tggcgagtat gaatgcgccg      1200
     cacggcacca acaggattca cgttgtgatc aagaaggcca acgagccgtt aggcgaagtc      1260
     attgtcgatc gtgacgcatt tgcgcagttc gtcgagggcg gcgcaccgac ggctgccagt      1320
     acctctctga cgatgcgtac gcgtccgacc tacgacgcgg attcgatcgc ctggcatggc      1380
     aacgaacaca cacatggtct gacgcggatt cagatcgagc cgatcgtcag ttacctgtac      1440
     ggcaccgagt acggcaattt cgacatctcg ctgggcgcca acattcaggg gttcgtgccg      1500
     ctttggcgcg gcgcggagtt gtacgcgagc tatatcgcac cgatctacaa cacgaagaac      1560
     atggacgaag gccgcgtgtt cagcgactac cgcttgcgcg gcggcctgaa tgcggtggcg      1620
     cttgctcaaa gcttctggat catgccgcga gtgttcaacg tggcatcggt cggcaagttc      1680
     gactactcgt atgtcggtgt gcaaaacgaa accacggtgt tcgtgcccgg acgtcccgat      1740
     ctgatccgcc tgcggctcgc ttatttgcac catgaaccgg gccatgacga actgcctggt      1800
     gagaagaatg ccgagttgac ttaccgctgg gtgcagccgt cctggaagct gtggatcgag      1860
     gctggcgtcg cacgctttgt tggcggggac aaggggccgg ttgcgacgat tacgcgctgg      1920
     ttcgacgacg tatcggtgag cgtgcatggc gagcatagcg ggcagggcac gtttgtgggc      1980
     gccgcgatca gcttcccgct gacgttgcgg cagggcatga agccgggaat cagtcaggtg      2040
     tatggcgctg aacagttcgg gctcgacttc cgcacacgcg tgggatcgac gaatttcctg      2100
     tcgcccaatg ctgcggagaa catgaccttc ccgtatagca cgcagcaata cctgttgaat      2160
     cagggccgct tcagcggtga gtacttctcg acacagcttt accggatgcg tgatgcgtat      2220
     ctgcgttacg ggcggcctgg aagcgacgaa acaaagccga agcagcaagt gagcgcgcct      2280
     gctatatcgg cgggcagcac gctttcgcgt cgcctctgtg gccgcggttt gcagggtgtg      2340
     gacgatggac cggcgttggc gccggtcaat tgtgagtga                             2379
//

If you have problems or comments...

PBIL Back to PBIL home page