(data stored in ACNUC7421 zone)

EMBL: CP000271.PE233

CP000271.PE233       Location/Qualifiers
FT   CDS_pept        272489..273205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2794"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2794"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33201"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT8"
FT                   /protein_id="ABE33201.1"
FT                   /translation="MKLLNGAALRTLQFGSIVLATSALVACGGGGDSPGATVSGTAAVG
FT                   QPLANAGIVLTCKNGAGSATANASGAYSATFHFDGPCAITASSGSTVLHSFAAGAGTYN
FT                   VTPLTELLLSYLAGQLGTTVSGLLSGISSNATYQGVLSNSTVVANAQAAVAQLIKTQYG
FT                   VTLSSSSFLTVSFAPGQPPDIDLDSLQTAGAITASGQPAPSLTTAVVGAGAAAPISGGG
FT                   NGGGATGGTGGSGGAT"
     atgaagcttc taaacggcgc cgcgttgcgc acgctgcagt tcggatcgat agttctggca        60
     accagcgcac tggttgcatg tggcggcggc ggcgattcgc ctggcgcgac ggtgagcggc       120
     acggctgccg tgggccagcc attggcaaac gccggcattg tactgacttg caagaacggc       180
     gcgggcagtg cgacggccaa cgcaagcggc gcatattcgg caactttcca ctttgatgga       240
     ccgtgtgcga tcacggcgtc gagcgggtct accgtgctcc attcgtttgc tgccggcgcg       300
     ggcacttaca acgtgacccc attgaccgag ttgctcctga gctatctggc cggtcagctt       360
     ggaaccacgg ttagcggact gctgtcagga atttcgagca acgctacata tcagggcgtg       420
     ctgtccaaca gcacggtggt cgcgaacgca caggcagctg tagcgcaact gatcaagaca       480
     cagtacgggg tcacgctttc gtcatcttca ttcctgacgg tttcgttcgc gcctggccag       540
     ccgccggata ttgatctgga cagtctgcag acggcaggcg cgattaccgc gagtggccag       600
     ccggcgcctt cgttgacgac cgcggtggtg ggggcgggtg cggccgcgcc gatctccggc       660
     gggggtaacg gcggtggagc aaccggtggc acggggggct ccggcggcgc gacgtaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page