(data stored in ACNUC7421 zone)

EMBL: CP000271.PE234

CP000271.PE234       Location/Qualifiers
FT   CDS_pept        complement(273307..273615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2793"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33202"
FT                   /db_xref="GOA:Q13RT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT7"
FT                   /protein_id="ABE33202.1"
FT                   /translation="MGEFIPEYLIREQAALGALVLFGVLRIVAAAVAAEKSWRVSVMQG
FT                   YCILIAVLYCLPQLFDLLTHAYGMQAAAAAAELEGKAAGSAIALFFSPILSHRLGYE"
     atgggcgaat tcattccaga gtatctgatc cgtgaacagg cggctttggg tgcacttgta        60
     ttattcggag ttctgcgcat tgtcgccgct gctgtcgccg ccgagaagag ctggcgcgta       120
     tcggtcatgc aaggttattg catactgata gccgtgctgt actgcctgcc ccagctattc       180
     gatctgctca cgcacgcgta tggaatgcaa gccgccgctg cggccgcgga actggaaggc       240
     aaagcagcgg gctctgcgat tgccctgttc ttctcgccta ttctgagtca taggctcggc       300
     tacgaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page