(data stored in ACNUC7421 zone)

EMBL: CP000271.PE235

CP000271.PE235       Location/Qualifiers
FT   CDS_pept        complement(273853..274137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2792"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33203"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT6"
FT                   /protein_id="ABE33203.1"
FT                   /translation="MREFAHSVTHIEAALFALAIIGASSASALQAVLRSPILDSDHQQD
FT                   DLTGSRKRVHHYLGIKPASFSERRLFFFAAIANGGKEAIACHHDMRRAW"
     gtgcgagagt ttgcacactc cgtcacccat atcgaagcgg ccttattcgc attggccata        60
     attggggcat cttccgccag cgcgttgcag gcagtgcttc gctctcctat tcttgattca       120
     gatcatcagc aagatgatct gacgggctcg cgcaagcggg tccatcatta cctcggaatt       180
     aagcctgcct ctttttcaga gcgcaggctc ttttttttcg ctgccatcgc aaacggcggg       240
     aaagaagcta tcgcctgcca tcatgatatg cgacgcgcat ggtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page