(data stored in SCRATCH zone)

EMBL: CP000271.PE238

CP000271.PE238       Location/Qualifiers
FT   CDS_pept        complement(276295..276492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33206"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT3"
FT                   /protein_id="ABE33206.1"
FT                   /translation="MQLPNVDNFIKDVQRGVTYNICAYRKLSGQEMTRAMQVFIQQQGQ
FT                   HQPKQGSVVKIFSLVGLGEQ"
     atgcagctac cgaacgtgga taacttcatc aaggacgtac agcgcggcgt cacctacaac        60
     atctgcgctt atcgcaaact ctcaggccag gagatgacgc gggcaatgca agtgttcatt       120
     cagcaacagg gccagcatca accgaagcaa gggtccgtgg tcaagatttt ttccctggtc       180
     ggtcttggcg aacagtag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page