(data stored in SCRATCH zone)

EMBL: CP000271.PE239

CP000271.PE239       Location/Qualifiers
FT   CDS_pept        276838..277101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33207"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT2"
FT                   /protein_id="ABE33207.1"
FT                   /translation="MARRLHKLDFRTLSITRTVMQPDHTATEFAPPPSLLATPLEGADE
FT                   STPQRQIGALARVTFCFAWLFGLEPFLTGAAGEMPLSRSDRH"
     atggcacgtc gtttgcataa gctcgacttc cggaccttat ccataacgag aaccgtcatg        60
     caacccgacc acaccgcgac tgagtttgcc ccgcctccat ccttgctggc cacgccgctg       120
     gaaggcgccg atgagagtac gccgcaacgg cagatcggcg cgttggcacg agtcactttc       180
     tgctttgcat ggctattcgg actcgagccg ttcctgaccg gtgccgccgg cgagatgcct       240
     ctttcacgtt cagatcgcca ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page