(data stored in SCRATCH zone)

EMBL: CP000271.PE240

CP000271.PE240       Location/Qualifiers
FT   CDS_pept        277216..277515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33208"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RT1"
FT                   /protein_id="ABE33208.1"
FT                   /translation="MCPCGTGEFAPGPVCRDEEALRRLRHKSRVTRPWAVVIRETPCEK
FT                   RHGRAVKWTRTVVRRFAVRFQHGFCHAAVGAAFHLRAMPVLKVFLFGRVTDAFK"
     gtgtgcccgt gcggaaccgg tgagttcgcg ccgggacccg tttgcaggga tgaagaggcg        60
     ctgcgccggt tgcgacacaa gtcacgagtc acaaggccgt gggcggtggt aattagggaa       120
     actccgtgtg aaaaacggca cggccgtgcc gttaaatgga cacggacggt cgttcgacgt       180
     tttgccgtcc gttttcagca cgggttttgt cacgcggcgg tcggcgccgc atttcacctc       240
     cgggcaatgc ccgtgctgaa ggtttttctc ttcggccgcg tgacggacgc ctttaaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page