(data stored in SCRATCH zone)

EMBL: CP000271.PE244

CP000271.PE244       Location/Qualifiers
FT   CDS_pept        complement(281890..282636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2783"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2783"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33212"
FT                   /db_xref="GOA:Q13RS7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS7"
FT                   /protein_id="ABE33212.1"
FT                   /translation="MNDAPLTAPADARPNRRERVARADLPGLFATCAWFRALAAEHQAL
FT                   VVASAHAEHMEGGAWIARRQEPSDYWIGVHSGLLKLAIYNASGRSCTLSGVPPGGWFGE
FT                   GSVIKRELRKYDVAAIQPSLVMFVPSDTFHALLESSLPFTGFVIRQLNNRMGEFIASIQ
FT                   NSRLLDVDARVAQSLAQLFNPDLYPDTGRALAISQEEVGLLAGVSRQRINQALQNLERL
FT                   QILRLSYNQIHVLDLERLTAFGREQI"
     atgaacgacg ctccgctcac cgctcccgcc gacgcccgtc cgaacaggcg cgagcgggtc        60
     gcgcgcgccg acctgccggg cctgttcgcc acctgcgcgt ggtttcgcgc actcgccgcg       120
     gagcatcagg cgctggtggt cgccagcgcg cacgcggagc atatggaagg cggcgcgtgg       180
     atcgcccggc gccaggagcc gtcggattac tggatcggcg tgcattccgg cctgctcaaa       240
     ctggccatct acaatgcttc gggacgcagt tgcacgctgt ccggcgttcc gccgggcggc       300
     tggttcggcg aaggcagcgt gatcaagcgc gaactgcgca aatacgacgt tgcggcaatt       360
     caaccttcgc tcgtcatgtt cgtgccgtcg gatacattcc atgcgctgct ggagtcgagc       420
     ctgccattca ccggtttcgt gatccggcaa ctgaacaacc gcatgggcga attcatcgcg       480
     tcgatccaga atagccggct actcgatgtc gacgcgcgcg tcgcacagtc gctcgcgcaa       540
     ctgttcaacc cggatctcta tccggatacc ggccgcgcgc ttgccatttc gcaggaagaa       600
     gtcggcttgc tggcgggcgt ttcgcgccag cggatcaatc aggcgctgca aaacctcgag       660
     cgcctgcaga tattgcgtct ttcgtacaac cagattcatg tgctcgacct ggaacgcctc       720
     accgcgttcg gccgggaaca gatctag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page