(data stored in ACNUC7421 zone)

EMBL: CP000271.PE246

CP000271.PE246       Location/Qualifiers
FT   CDS_pept        complement(284555..284779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2781"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33214"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS5"
FT                   /protein_id="ABE33214.1"
FT                   /translation="MQNTPIHHYNGYAVKPSAHRLPDGTFSSNLLLERADSARAEGRYQ
FT                   FYSLDYFTNEEQALQHSASWARHWVDTRG"
     atgcaaaaca cacctattca tcattacaac ggctatgccg tcaaaccctc ggcgcaccgt        60
     ttgcccgatg gcactttttc atcgaatctg ctgctcgaac gcgctgacag cgcgcgtgcc       120
     gaagggcgct accagttcta ttcgctcgac tatttcacga acgaagaaca ggccttgcag       180
     cactcggcaa gctgggcacg tcattgggtc gatacgcgcg gctaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page