(data stored in ACNUC7421 zone)

EMBL: CP000271.PE247

CP000271.PE247       Location/Qualifiers
FT   CDS_pept        complement(285068..285271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2780"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33215"
FT                   /db_xref="GOA:Q13RS4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS4"
FT                   /protein_id="ABE33215.1"
FT                   /translation="MDTGTVKWFNDSKGFGFITPDKGGDDLFAHFSEISGDGFKTLAEN
FT                   QKVSFETKQGPKGLQAANIKPM"
     atggataccg gtaccgttaa gtggttcaac gacagcaaag gctttggctt catcaccccg        60
     gacaagggcg gcgacgacct gttcgcgcac ttctccgaaa tcagcggcga cggcttcaag       120
     acgctggctg agaatcagaa agtgagcttc gaaacgaagc aaggcccgaa gggtctgcaa       180
     gcggctaaca tcaagccgat gtaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page