(data stored in ACNUC7421 zone)

EMBL: CP000271.PE248

CP000271.PE248       Location/Qualifiers
FT   CDS_pept        complement(285567..286202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2779"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33216"
FT                   /db_xref="GOA:Q13RS3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS3"
FT                   /protein_id="ABE33216.1"
FT                   /translation="MSASTAIIAILAALLVGAMSPGPSFVIVARNAIGLSRGDGLATAI
FT                   GMGVGGVFFSGIALLGLYTLLASVEWLYVGLKVAGGLYLIYLASKIWRGAAKPLAFDTT
FT                   QAVPANARKSFWIGLSTQLSNPKTAVYYGSIFAALLPQHPPLWCYFALPPAIFAIEAGW
FT                   YTVVALCFSSKRPREIYLQWKAWVDRVAASAVAALGLRLILTAHKVGI"
     atgtccgctt cgaccgccat catcgccatt ctcgccgcac tcctcgtagg cgcgatgagt        60
     cctggaccga gcttcgtgat cgtcgcccgc aatgcgatcg ggttgtcgcg cggcgatggt       120
     ctcgccaccg cgatcggcat gggcgtcggc ggcgttttct tcagcggcat cgcgctgctc       180
     ggcctctaca ccttgctggc gagtgtcgaa tggctctatg tcggcctgaa agtggcaggc       240
     ggtctttatc tgatctacct tgcgtcgaag atctggcgcg gcgcggccaa accgctcgca       300
     ttcgatacga cgcaggccgt cccggccaat gcccgcaagt cgttctggat cggcttgagc       360
     acacaactca gcaatccgaa gacagccgtc tattacggca gtattttcgc ggccctgttg       420
     ccgcaacatc cgccgctgtg gtgctacttc gcattgccgc ccgcgatctt cgcgatcgaa       480
     gccggctggt acaccgtcgt cgcgttgtgc ttttcgagca agcggccgcg cgaaatctat       540
     ctgcaatgga aagcgtgggt cgatcgcgtc gccgcgagcg cggtcgccgc gctgggattg       600
     cgcctgatcc tgacggcaca caaagtgggc atctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page