(data stored in SCRATCH zone)

EMBL: CP000271.PE249

CP000271.PE249       Location/Qualifiers
FT   CDS_pept        286332..286628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33217"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS2"
FT                   /protein_id="ABE33217.1"
FT                   /translation="MSNTACTRSIAKPAGIEKQRVAGSPVRCSGQKKLDARMTFHTLKQ
FT                   PRTTRQDKSAIRSGCRRVPPNAGFIGHDFQVRVLTHRNRHREFDSHSIHLNHA"
     gtgagtaata ccgcttgtac ccgcagcatc gctaaaccgg ccggaattga aaagcaacgc        60
     gtcgccggct ctcctgttcg ttgctccggc caaaagaaat tggatgctag aatgactttc       120
     catacgctga agcagcctcg aaccacgagg caagacaaga gcgcaattcg atccggttgc       180
     cgacgagttc cccctaatgc aggatttatc gggcatgatt ttcaggtgcg ggttttaacg       240
     caccggaaca ggcatcgcga gttcgattcg cactcgatcc atttgaatca cgcatag          297
//

If you have problems or comments...

PBIL Back to PBIL home page