(data stored in SCRATCH zone)

EMBL: CP000271.PE25

CP000271.PE25        Location/Qualifiers
FT   CDS_pept        complement(26152..27111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3004"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32993"
FT                   /db_xref="GOA:Q13SE6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SE6"
FT                   /protein_id="ABE32993.1"
FT                   /translation="MPTVAIAIFPGVQALDVAGPVDVFSEANRFIAPNNRYEVTLLGAE
FT                   STPLRASNGMTLVADATFSEARHTFDLALIAGGPALPERAPDARVLDWLANAASQCGRY
FT                   GSICTGAFALGHAGLLDGHNVTTHWQHAAQLAAQFPNARVDFDRIYLRDGPLVTSAGVT
FT                   AGIDLSLALVAEDHGPQIALAVAKRLVVFAQRQGGQSQFSPYLTAPADETSPVAKVQAH
FT                   VMERIRESFTVKQLADVAGMSARNFARVFVQETGVTPHEFVERARVDAARKLLESSGAA
FT                   LKAIAYDCGFGTADRMRIVFTKRIGATPMQYRERFRSP"
     atgcccaccg ttgcgatcgc catctttccc ggggtgcagg cgctcgacgt cgccggtccc        60
     gtcgacgtgt tttccgaagc caaccgcttc atcgcgccca acaatcgtta cgaggtcacg       120
     ctgcttggcg cggaatccac accattgcgg gcgtccaatg gcatgacgct ggtcgccgac       180
     gccactttca gcgaagcgcg tcacacgttc gatctcgcgc tcatcgcggg cggcccggcg       240
     ctgcccgaac gggcgccgga tgcacgcgtg ctggattggc tggcgaacgc cgccagccaa       300
     tgcggccgtt acggttccat ctgcaccggc gcattcgcgc tcggccacgc gggcttgctc       360
     gacggccaca acgtcaccac gcactggcag catgcggcgc aactggcggc gcaattcccc       420
     aacgcacgcg tcgatttcga ccgtatctat ctgcgcgacg gaccactcgt gacgtcagcg       480
     ggcgtaacgg ccggcatcga tctgtcgctt gctctggtcg ccgaagatca tgggccgcag       540
     atcgcgctcg cggtagccaa acgcctggtg gtgttcgcgc agcggcaagg cggtcagtcg       600
     caattcagcc cctacctgac ggcacccgcc gacgagacgt cgccggtcgc caaagtccag       660
     gcgcacgtca tggaacggat tcgcgagagc ttcacggtga agcagctggc cgatgtcgca       720
     ggtatgagcg cgcgcaactt cgcgcgggtg ttcgtgcagg agaccggcgt aacgccgcat       780
     gaattcgtcg aacgtgcccg tgtggacgcc gcacgcaagc tgcttgagag cagcggcgcg       840
     gcgctgaagg cgatcgcgta cgactgcggc ttcggcacgg cggaccgcat gcgcattgtc       900
     ttcaccaaac ggatcggcgc gacgcccatg cagtaccggg aacgctttcg gtcgccgtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page