(data stored in SCRATCH zone)

EMBL: CP000271.PE250

CP000271.PE250       Location/Qualifiers
FT   CDS_pept        286700..286963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33218"
FT                   /db_xref="GOA:Q13RS1"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS1"
FT                   /protein_id="ABE33218.1"
FT                   /translation="MKEREEQRLFDLDGNARERLIVWIRRRMDEYGITMEALAEAIEAD
FT                   ASATRAVMYRDAYGNTWDGHGDKPDWLARAIYAGQSMDHFRC"
     atgaaagagc gagaagaaca acggctgttc gacctcgacg ggaatgcgcg tgagcgcctg        60
     atcgtgtgga tccgccggcg catggacgaa tacggcatta cgatggaagc gctcgccgag       120
     gcgatcgaag cggatgcgtc cgcaacgcgg gccgtcatgt atcgcgacgc ctacggcaat       180
     acctgggacg gtcacggcga taagccggat tggctcgcac gcgcgattta cgccggacag       240
     agcatggatc atttccgttg ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page