(data stored in SCRATCH zone)

EMBL: CP000271.PE251

CP000271.PE251       Location/Qualifiers
FT   CDS_pept        complement(287144..287731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2776"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33219"
FT                   /db_xref="GOA:Q13RS0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RS0"
FT                   /protein_id="ABE33219.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYDFDFRSLFTPVVADREAAGE
FT                   HITIVGQVFDGDGKVIGDAMLEVSQVDANGRFPESREEILKTGFRGFARVGTGTDPHKR
FT                   FVVETVKPGRVGPDEAPHLNVVVTMRGMLLHTFTRIYFEDETAANEKDPVLTAVPADRR
FT                   DTLIARREPNVANIYRFDIHMQGEKETVFFDL"
     atgaccaccc tcaagcaaac gccttcgcaa acggttgggc cctacttcgc gtacggcctg        60
     tgcccgcagc aatacgattt cgatttcagg agcctgttca cgcctgttgt ggctgatcgc       120
     gaagcggccg gcgagcacat cacgattgtc ggccaggtgt tcgacggcga cggcaaagtg       180
     atcggcgacg ccatgctcga agtgtcgcaa gtggatgcga acgggcgttt cccggagtcg       240
     cgtgaagaaa tcctgaagac gggctttcgc ggcttcgcgc gcgtgggcac cggtaccgat       300
     ccgcacaagc gctttgtggt ggaaacggtg aagcccggcc gcgtgggtcc ggatgaagcg       360
     ccgcatctga atgtggtcgt gaccatgcgc ggcatgctgc tgcacacctt cacgcgcatc       420
     tatttcgagg acgaaaccgc ggcgaatgaa aaagacccgg tattgacagc ggttccagcg       480
     gatcgccgcg acacgctgat tgcgcgccgt gagccgaatg tggcgaacat ttaccgcttt       540
     gatattcaca tgcagggcga gaaggaaact gtctttttcg acctgtaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page