(data stored in SCRATCH zone)

EMBL: CP000271.PE252

CP000271.PE252       Location/Qualifiers
FT   CDS_pept        complement(287735..288439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2775"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Protocatechuate pathway; Citation: Biochem. Biophys.
FT                   Res. Commun. 295 (4), 903-909 (2002)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33220"
FT                   /db_xref="GOA:Q13RR9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR9"
FT                   /protein_id="ABE33220.1"
FT                   /translation="MDESFLTARDFASHPSYIYPGYGSSVKRGPTRPLIPLKEKLRDQH
FT                   VPVYGTEDLGALDHDLTRNAVRNGEPLGERIIVTGRVLDEGNRPVRNTLVEIWQANAAG
FT                   RYVHKADQHDAPLDPNFLGAGRCITDNEGRYRFMTIKPGAYPWGNHPNAWRPNHIHFSL
FT                   FGDHFGSRLVTQMYFPGDPLLAFDPIFQGTPEHARDRLIANFSLDTTQEAYALGYDFDI
FT                   VLRGRNETPMER"
     atggacgagt cctttctcac cgcgcgtgat ttcgcgtcgc atccttctta catctatcct        60
     ggctacggtt cgtcggtcaa acgcggcccg acgcgtccgc tgattccgct gaaagaaaag       120
     ctgcgcgatc agcacgtgcc cgtctacggc accgaagacc tcggcgcgct cgatcacgat       180
     ctgacgcgta acgccgtgcg caacggcgag ccgctcggcg agcgcatcat cgtgacgggc       240
     cgcgtgctcg acgaaggcaa ccgcccggtg cgcaatacgc tggtcgaaat ctggcaagcc       300
     aacgccgccg gccgctatgt gcacaaggcc gaccagcacg acgcgccgct cgacccgaat       360
     tttctcggcg cgggccgctg catcacggac aacgaaggcc gctaccgttt catgacgatc       420
     aagcccggcg cgtacccgtg gggcaaccat ccgaacgcct ggcgtccgaa ccatatccat       480
     ttctcgctgt tcggcgacca tttcggctcg cgcctcgtca cgcagatgta ctttcccggc       540
     gacccgctgc tggcgttcga cccgatcttc cagggcacgc ccgagcatgc ccgtgaccgt       600
     ctgatcgcga acttttcgct cgacaccacg caggaagcct atgcgctcgg ctacgacttc       660
     gacatcgtgc tgcgcggccg caacgaaact ccgatggagc gctaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page