(data stored in SCRATCH zone)

EMBL: CP000271.PE256

CP000271.PE256       Location/Qualifiers
FT   CDS_pept        292120..293157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2771"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2771"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33224"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR5"
FT                   /protein_id="ABE33224.1"
FT                   /translation="MRNIKNANVEQLLLKLLGADKTARLFATLNHPQILNEWEAGIVTR
FT                   AELAQAMNMALFEDLLARSANGRRYTEEAVAAGGSVYFDHGALRTVRWPHSGALPMGEA
FT                   AFARILRPLGFSINGRYPLDRLGMTGRAWAHDDAPDEIAQFFVSELHPERFSAEFQQAV
FT                   TNVIGESRDPLTPRALGQLWELERDGVLPLDAAHELLPVMVGAFACQHETPREADYEVL
FT                   LKESAEMAWIATEGNAFNHATDRVADVFQLSDDEKAKGRPMKPEVERSRSGRVFQTAYR
FT                   ADTVLREFRAADASIVTREVPGSFYEFITRKRTFDQDARRWETDLRFDAGNAQGIFKMT
FT                   ANQAA"
     atgcgaaaca tcaagaatgc gaatgtcgaa caactgctgt tgaaactcct cggcgccgac        60
     aaaaccgccc ggctcttcgc gacgctgaat catccgcaga tcctcaacga atgggaagcc       120
     ggtatcgtca cgcgcgccga actcgcgcag gcgatgaaca tggcgctttt cgaggatctg       180
     ctggcgcgct cggcaaatgg ccgccggtac acggaggagg cggtcgcggc gggcggcagc       240
     gtgtacttcg accacggcgc gttgcgcacc gtgcgctggc cgcacagcgg cgcgctgccg       300
     atgggcgaag ccgcgtttgc gcgcattctg cgtccgctcg gcttcagcat caacggccgt       360
     tatccgctcg accgcctcgg catgaccggc cgcgcgtggg cacacgacga cgcgcccgat       420
     gaaatcgcgc agttcttcgt cagcgaattg catcccgagc ggttttcggc ggagtttcag       480
     caggcggtga ccaatgtgat cggcgagtcg cgcgatccgc tgacgccgcg tgccctcggc       540
     cagttgtggg agctcgaacg cgacggcgtg ttgccgctcg acgcagcgca tgaactgctg       600
     ccggtcatgg tcggcgcgtt tgcgtgccag cacgagacgc cacgcgaagc cgattacgaa       660
     gtattgttga aggaatcggc ggaaatggcg tggatcgcga ctgaaggcaa cgcgttcaac       720
     cacgccaccg atcgcgtcgc ggacgtcttt caactctccg acgacgagaa ggccaagggt       780
     cgtccgatga aaccggaagt ggagcgctcg cgctcaggcc gcgtgttcca gacggcgtat       840
     cgcgccgaca ccgtgctgcg cgagtttcgg gcagccgacg caagcatcgt gacgcgtgaa       900
     gtgccgggtt cgttctacga gttcatcacg cgtaagcgga ctttcgatca ggacgcgcgt       960
     cgttgggaaa cggacctgcg tttcgacgcg ggcaacgcac agggcatctt caagatgacc      1020
     gcgaaccagg ctgcgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page