(data stored in ACNUC7421 zone)

EMBL: CP000271.PE259

CP000271.PE259       Location/Qualifiers
FT   CDS_pept        complement(297066..297806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2768"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2768"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33227"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR2"
FT                   /protein_id="ABE33227.1"
FT                   /translation="MKTTNRHHTMHLIHATSPRHTAMRISFLHTMDGNRQVFEQAAKTL
FT                   GMRAEDLHHEVRADLREAVTQTGTFSSELKAETNQRLLALAAHSDAVILTCATLGPAVA
FT                   DIGHSPVPIVRADIALAAAAAEAGGKIVVLCAAESAVESTRKLFVEQASGNNASVEVVH
FT                   LPEVWALFKAGALDACLAAIALAADDAYEAGATVVAFAHPWMAPGADLVRKGRRPLDSP
FT                   SAALRAAAQRFSESSASSAKASFR"
     gtgaaaacca ccaaccggca tcacacgatg catctgattc acgcaacttc accgaggcat        60
     acggcaatgc gtatttcgtt tctgcacacg atggacggca accggcaagt ctttgagcag       120
     gcggcaaaaa cgcttggaat gcgggctgaa gatctgcacc atgaagtgag agcggacctg       180
     cgcgaagcgg tcacgcagac ggggacgttc tcaagcgagt tgaaagccga gacaaaccag       240
     cgtcttctcg cgctggcagc ccattccgac gctgtgattc tgacttgcgc gacgctcggg       300
     ccggccgtgg cggatatcgg gcattcaccg gtgcccattg tcagagcgga tattgcattg       360
     gccgcagcgg cagcagaagc gggcggaaaa atcgtggtgt tgtgtgccgc tgaatccgca       420
     gtcgaatcca cgcggaagct cttcgtggag caggcaagcg gaaataacgc gtcagtggag       480
     gtcgttcacc ttcccgaggt ctgggcactg ttcaaagcgg gtgccctcga cgcgtgcctg       540
     gccgcaatcg cactggccgc ggacgacgcg tatgaagcag gcgccaccgt ggtcgcgttc       600
     gctcacccgt ggatggcacc cggcgcggac ctcgtccgca agggaagacg gccgctcgat       660
     agtccgagtg cggcacttcg cgctgcagcg caacggttca gcgaatcttc cgcctcgtcc       720
     gcaaaggcaa gtttccgatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page